KEGG   Stigmatella aurantiaca: STAUR_5234Help
Entry
STAUR_5234        CDS       T01425                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_5234 (tpiA)
   01230 Biosynthesis of amino acids
    STAUR_5234 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_5234 (tpiA)
   00051 Fructose and mannose metabolism
    STAUR_5234 (tpiA)
   00562 Inositol phosphate metabolism
    STAUR_5234 (tpiA)
Enzymes [BR:sur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STAUR_5234 (tpiA)
Exosome [BR:sur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STAUR_5234 (tpiA)
  Exosomal proteins of bladder cancer cells
   STAUR_5234 (tpiA)
  Exosomal proteins of melanoma cells
   STAUR_5234 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6482956..6483726)
Genome map
AA seq 256 aa AA seqDB search
MAAEARRKIVAGNWKMNKTVPEALALVRELRGLVSALGDKVELVIAPPFVALHPVAKAIE
DSNLKLAAQNCHWEASGAFTGEVAAPMLKEVGCAYVIVGHSERRQFFGETDETVNKRSQA
VLKAGMVPIICVGETLAEREANRTLEVVERQVKGALAGFSAADVARFVLAYEPVWAIGTG
RTATSAQAQEVHAAIRSQLARLYDGAAAGQVRIQYGGSVKPDNAAELLGQPDVDGALVGG
ASLKAGDFAAIVKAGA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgaagcgcgccggaagatcgtcgctggcaactggaagatgaacaagaccgtc
cccgaggcgctcgccctggtgcgagagctgcgggggctggtctcggcgctgggtgacaag
gtggaactcgtcatcgcgccccccttcgtggcactgcacccggtggccaaggccatcgag
gactcgaacctgaagctggcggcacagaactgccactgggaagcctccggggcgttcacc
ggcgaggtggccgcgccgatgctgaaggaggtgggctgtgcctacgtcatcgtcggccac
tccgagcgccgccagttcttcggggagacggatgagacggtgaacaagcgctcccaggcc
gtgctcaaggcgggcatggtgcccatcatttgcgtgggcgagacgctggcggagcgtgag
gcgaaccggacgctggaggtggtggagcgccaggtgaagggggcgctggccggcttcagc
gcggcggacgtggcccggttcgttctggcgtatgagcccgtttgggccatcggtacaggc
cgtacggccacgagcgcccaggctcaggaagtccatgcggccatccgctcgcagcttgcc
cggctgtacgatggggcggcggcggggcaggtgcggattcagtacggcggcagcgtgaag
ccggataacgccgcggaattgttgggacaaccggatgtggatggggctttggtggggggc
gcgagcctgaaggcgggcgacttcgcggccatcgtcaaggcgggggcatga

DBGET integrated database retrieval system