KEGG   Stigmatella aurantiaca: STAUR_5292Help
Entry
STAUR_5292        CDS       T01425                                 

Definition
glucose-methanol-choline family oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
sur  Stigmatella aurantiaca
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    STAUR_5292
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     STAUR_5292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6556988..6559357)
Genome map
AA seq 789 aa AA seqDB search
MRQLSSSLERLGEHWPVVIVGSGYGGAIAASRLARAGQKVCVLERGKERLPGEFPRTSGQ
LLKDVQMSGPGGSLLGKLRLGSPTGLLSLHLLGDVAVLTGCGLGGTSLINANVALRPDPR
VLQDESWPAAFRADIGGRIADGFTHVERMLGVQPYPENRPAPRKLNLLEQAAEAVGGRFF
RPPLSIHFEAGVNPAGVRQGACTLCGDCATGCNVGAKNSTQMNYLPDAQRHGAELFTHVA
VHHLARHQGHWRVYYRLVGVGREVFDSPLQFLTADRVILSAGTLGSTEILMRSRAAGLPL
SRELGRHFSGNGDLMGFGYNLDVPVDSVGYGDEPMEGRGPVGPSITGVIEVKDPDSMERS
MVVEEGAVPAALGGYLPTLFAAVAPIMGEDTDEGFVDGMKEQARVMEGLVRGPYHGALHH
TQTLFVMSHDSGSGELRLDGDSLRVVWPGVGRQENFVRGDQKMRKATEVFGGTYVRNPMG
TRWLDNAILVTHPLGGCVMAEDAASGVVDHEGRVFSEESGTAVHAGLYVCDGAVIPRSLG
TNPFLTISAVAERFCALMAQREGWHIDYSALPGQLPPAPAKPVGLRFTESLQGIISGAVD
EDYREAAAPDRAGASSFRFIITVLVADVNALLDDPMHATRVTGCVLAPGLSPQPLTVTKG
TLQVLVPDPQQPSVKQMRYRMQLLAESGERFFFEGFKQLVDDPGLDMWEDTTTLFVTVRR
GEGPGDPLIQKGVLRITLDDFARQCSTFRVTNASSTQEQLHAVGRFGRFFLGGLFDIYWK
PVGPEELTA
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcagctgtcctcttctcttgagagattgggtgaacactggcccgtggtgatcgtg
ggttcgggttacgggggagccattgccgcctcccggttggcccgggcggggcagaaggtc
tgcgtcctggagagaggcaaggagcgtttgccgggcgagtttccccggaccagtggccag
cttttgaaagatgtgcagatgtccgggccaggcgggagcctgctgggcaagcttcggctc
gggtcccccacgggattgctctcattgcacctgctgggcgatgtggccgtgctcaccggg
tgcggcctgggaggcacctcgctcatcaatgccaatgtggcgctgcggccggacccgcgc
gtcctccaggacgagagctggcccgcggcattccgcgcggacatcggcggccggatcgcg
gatggtttcacccacgtggagcggatgctgggcgtccagccgtatcccgagaaccgcccc
gcccctcgcaagctgaacctgctggagcaggccgcggaagcggtgggaggacggttcttc
cgccccccgctgagcattcacttcgaggcgggggtcaaccccgcgggggtccggcaggga
gcctgcacgctctgcggagactgcgccaccggctgcaacgtgggtgccaagaacagcacg
cagatgaactacctgccggacgcgcagcgccacggcgcggagctgttcacgcacgtggcc
gtgcaccacctggcgcgtcaccaaggccactggcgcgtgtactaccggctggtgggggtg
ggccgcgaagtgttcgactcgccgctccagtttctcaccgcggaccgggtcatcctgtcg
gccggcaccctgggcagcacggagatcctcatgcgctcgcgggcagcggggctgcccctg
tcgcgggagctgggccggcacttctccggcaacggggatctgatgggctttgggtacaac
ctggacgtgcccgtggacagcgtggggtacggggatgagcccatggagggcagggggccc
gtggggccctccatcaccggggtcatcgaggtgaaagacccggactcgatggagcgcagc
atggtggtcgaggagggggcggtcccggcggccctgggaggctatctgcccaccctgttc
gcggcggtggcgcccatcatgggggaggacacggacgagggcttcgtggacgggatgaag
gagcaggcccgggtgatggaggggctggtgcgcgggccctaccatggggcgctgcaccac
acccagacgctcttcgtcatgtcccatgactcggggagcggggaactgcggctggatggg
gacagcctgcgcgtcgtctggccgggcgtggggcggcaggagaacttcgtccggggggac
cagaagatgcgcaaggccaccgaggtgttcgggggcacctacgttcgcaacccgatggga
acccggtggctggacaatgccattctcgtcacacacccgctcgggggctgcgtcatggcg
gaggacgcagccagtggggtggtggaccacgagggccgcgtcttctcggaggaatcaggc
acggcggtccacgcgggactctatgtctgcgatggggccgtcatcccccgctcgctgggc
accaatcccttcctcaccatctccgcggtggccgagcgcttctgcgcgctcatggcgcag
cgggagggctggcacatcgactattcggcccttccggggcaattgccgcccgcgcccgcg
aagcccgtgggcctgcgcttcaccgagagcctgcagggcatcatctctggcgcggtggac
gaggactaccgcgaggccgcggcgccggatcgggcaggggcctccagcttccgcttcatc
atcacggtgctcgtggcggacgtgaacgccctgctggacgacccgatgcatgccacgcgg
gtgaccgggtgtgtgctggcaccggggctctcccctcagccgctgacggtcaccaagggg
acgctccaggtcctcgtgccggatccccagcagccctcggtcaagcagatgcgctacagg
atgcagttgctggccgagtccggggagcgcttcttcttcgaggggttcaagcaactggtg
gacgacccaggcttggacatgtgggaggacaccacgacgctcttcgtcaccgtgcggcgc
ggagaggggcccggcgatcccctgatccagaagggcgtgctgcgcatcaccctcgatgac
ttcgcccggcagtgctccaccttccgggtgacgaatgcctcgagcacgcaggagcagctc
catgcggtgggacgcttcgggcgcttcttcctgggggggctcttcgacatctattggaag
ccggtgggccccgaggaactgacggcctga

DBGET integrated database retrieval system