KEGG   Stigmatella aurantiaca: STAUR_5314Help
Entry
STAUR_5314        CDS       T01425                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sur  Stigmatella aurantiaca
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_5314
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    STAUR_5314
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STAUR_5314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6590119..6592863
Genome map
AA seq 914 aa AA seqDB search
MKRLLMSLPLAAILASGCSDSDSKPDPVDPDPPNPPAPSLPAQLAVQFQPVDHSVGSWKF
FRATFTLENQGTSEIGNNGWKLYFSFVRRILSEGEGDDTGIQELTKQGVRIALADNAASG
DYYVLEPIDTFKPIAPGEKREISVLISDWAILKADAPAGFHIAFAGEDFKNVAFAVPSTV
KLDASDPKQTTRFEGDVMPVQTASLRYDENPSAQSLDLKARLLPTPRRVEAGAGEVPLSG
NVFIGHTANLKGEADYLAAALGDVLNASITARPAAGGEQISLSIDPNLDVTGDGVRDPEG
YQLDVREGSVKILGADASGVFYGIQTLRQLISPQAYQAASKREGRLTQIALPEARITDAP
GFVYRGMHLDVGRHFQSKETVKKLLDVISHFKINKFNIHLTDDEGWRLETPGIPELTSYG
ARRGFDLAEAEMLHAGLGSGSDLQDGDLIRLKPATPQKANAETPPAYQGFETATLNFVGK
GSGYYTTKDFEEILKYATERHIEVIPEIDVPGHARAAVKAMEYRYRKLKDLDPAQAAAYR
LIDPNDTSKHKSVQGYTDNFINPCLDTSYAFLTKVAEEIKARYAAAGAPLKTIHAGGDEL
PALNPNVWWQGSPLCKANPATKDMDDHQLFNHFFTRWNQIIKATGAEMTGWDDIIHNGLT
LPGFIPMPWSNVWGWGREDDAYKYANQGYQVILSHSTNLYMDLAYNKDPDEPGYYWANFV
DEKKTFEYRPFDIYANATHDRMGNAIKPEDLASKVRLTAEGKKNILGMHGLLWGENLKTP
EVVEYLAFPKVLGVAERAWNPELPEVSAMPALWGQFTNSLGQYVLPRLGAYRPVDLRDEL
PESVGVNYRIPLPGGRLIDGKLHANVRFPGLAIEYSTDDGRTWTAYTEPVAAPQKTLLRT
RTLDGRSSRVTGLN
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggctcctcatgtccctgcccctcgcggccatcctggcctcgggctgttctgac
tccgactccaagccagaccccgtcgaccccgatccccccaacccaccggcgcccagcctc
ccggcccagctcgcggtccagttccagcccgtggaccactcggtgggcagctggaagttc
ttccgcgccaccttcaccctcgagaaccaggggacgagtgagatcggcaacaacgggtgg
aagctctacttcagcttcgtccggcggatcctctcggagggcgagggagacgacacgggg
atccaggagctcacgaagcagggcgtccgcatcgcactcgcggacaacgccgcgagcggc
gactactacgtgctggagcccatcgacacctttaagccgatcgcccctggcgagaagcgc
gagatcagcgtgctgatcagcgactgggccatcctgaaagcggatgcgcccgccgggttc
cacatcgcgttcgcgggtgaagacttcaagaacgtcgccttcgccgtgccctcgacggtc
aagctggacgcctccgatccgaagcagaccacgcgcttcgagggagacgtgatgcccgtg
cagaccgcctccctgcgctacgacgagaatccttcggcccagagcctggatctcaaggca
cggctcctgcccactccccgccgggtcgaggcgggcgcgggcgaggtgccgctcagcggc
aacgtcttcatcggtcacaccgccaacctgaagggtgaggcggactacctcgcggccgcc
ctgggggatgtgctgaacgcgtccatcaccgcccggccggccgcgggcggcgagcagatc
tccctgagcatcgatcccaacctcgacgtgaccggggacggcgtccgcgatccggagggc
taccagctcgatgtgcgggaagggagcgtgaagatcctcggcgccgacgcctcaggggtg
ttctacggcatccagacgctccgccagctcatctccccccaggcctatcaggcggcgtcg
aagcgcgagggccgcctcacgcagatcgcccttccggaggcccgcatcaccgacgccccg
gggttcgtctatcgcggcatgcacctggatgtggggcgccacttccagtccaaggagacc
gtcaagaagctgctcgatgtgatctcccacttcaagatcaacaagttcaacatccacctg
accgacgacgagggctggcggttggagacgccgggcatccccgagctgacgagctacggc
gcgcgccggggcttcgatctcgcagaggccgagatgctccacgcggggctcggctcaggc
agtgatcttcaggacggagatctcatccgcctcaagccggccacgccgcaaaaggccaac
gcagagacgcctccggcctaccagggcttcgagacggcgacgctcaacttcgtgggcaag
ggaagcggctactacaccaccaaggacttcgaggagatcctcaagtacgccacggaacgg
cacatcgaggtcatccccgagatcgacgtgccgggccacgcccgggccgccgtcaaggcc
atggagtaccgctaccggaagctcaaggacctggatcccgcccaggcggccgcttaccgg
ctgatcgatccgaacgacacctccaagcacaagagcgtccagggctacacggacaacttc
atcaacccgtgcctggacacctcgtacgccttcctgaccaaggtcgccgaggagatcaag
gcacgctacgccgcggcaggcgcgccgctgaagaccatccacgcgggaggcgatgagctg
cccgcgctgaacccgaacgtgtggtggcagggctccccgctctgcaaggccaaccccgcg
accaaggacatggatgaccaccagctcttcaaccacttcttcacgcgctggaatcagatc
atcaaggcgaccggcgcggagatgacgggctgggacgacatcatccacaacgggctcacc
ctgccagggttcatcccgatgccgtggagcaacgtctggggctggggccgcgaggatgac
gcgtacaagtacgccaaccagggctaccaggtcatcctgtcccactcgacgaacctctac
atggacctggcctacaacaaggatcccgacgagccgggctactactgggccaacttcgtc
gacgagaagaagacgttcgagtaccggcccttcgacatctacgccaacgccacccacgac
cggatgggcaacgccatcaagccggaagatctggcgagcaaggtccgcctcacggcggag
ggcaagaagaacatcctcggcatgcacggcctgctctggggcgagaacctgaagacgccc
gaggtggtcgagtacctcgccttcccgaaggtgctcggcgtcgccgagcgcgcgtggaac
ccggagcttccggaggtgagcgcgatgccggccctgtggggccagttcaccaacagcctg
gggcagtatgtgctgccgcgcctgggggcctaccggccggtggatctgcgcgatgagctt
cccgagagcgtgggcgtgaactaccgcatcccactccccggcggccgcctcatcgacggc
aagctgcacgcgaacgtgcgcttcccgggcctcgccatcgagtactcgaccgacgacggc
aggacctggacggcgtacacggagcccgtggcggctccccagaagacgctgctcaggacc
cggacgctcgacggacgcagcagccgcgtcaccgggctcaactaa

DBGET integrated database retrieval system