KEGG   Stigmatella aurantiaca: STAUR_5314Help
Entry
STAUR_5314        CDS       T01425                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sur  Stigmatella aurantiaca
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sur00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sur00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6590119..6592863
Genome map
AA seq 914 aa AA seqDB search
MKRLLMSLPLAAILASGCSDSDSKPDPVDPDPPNPPAPSLPAQLAVQFQPVDHSVGSWKF
FRATFTLENQGTSEIGNNGWKLYFSFVRRILSEGEGDDTGIQELTKQGVRIALADNAASG
DYYVLEPIDTFKPIAPGEKREISVLISDWAILKADAPAGFHIAFAGEDFKNVAFAVPSTV
KLDASDPKQTTRFEGDVMPVQTASLRYDENPSAQSLDLKARLLPTPRRVEAGAGEVPLSG
NVFIGHTANLKGEADYLAAALGDVLNASITARPAAGGEQISLSIDPNLDVTGDGVRDPEG
YQLDVREGSVKILGADASGVFYGIQTLRQLISPQAYQAASKREGRLTQIALPEARITDAP
GFVYRGMHLDVGRHFQSKETVKKLLDVISHFKINKFNIHLTDDEGWRLETPGIPELTSYG
ARRGFDLAEAEMLHAGLGSGSDLQDGDLIRLKPATPQKANAETPPAYQGFETATLNFVGK
GSGYYTTKDFEEILKYATERHIEVIPEIDVPGHARAAVKAMEYRYRKLKDLDPAQAAAYR
LIDPNDTSKHKSVQGYTDNFINPCLDTSYAFLTKVAEEIKARYAAAGAPLKTIHAGGDEL
PALNPNVWWQGSPLCKANPATKDMDDHQLFNHFFTRWNQIIKATGAEMTGWDDIIHNGLT
LPGFIPMPWSNVWGWGREDDAYKYANQGYQVILSHSTNLYMDLAYNKDPDEPGYYWANFV
DEKKTFEYRPFDIYANATHDRMGNAIKPEDLASKVRLTAEGKKNILGMHGLLWGENLKTP
EVVEYLAFPKVLGVAERAWNPELPEVSAMPALWGQFTNSLGQYVLPRLGAYRPVDLRDEL
PESVGVNYRIPLPGGRLIDGKLHANVRFPGLAIEYSTDDGRTWTAYTEPVAAPQKTLLRT
RTLDGRSSRVTGLN
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggctcctcatgtccctgcccctcgcggccatcctggcctcgggctgttctgac
tccgactccaagccagaccccgtcgaccccgatccccccaacccaccggcgcccagcctc
ccggcccagctcgcggtccagttccagcccgtggaccactcggtgggcagctggaagttc
ttccgcgccaccttcaccctcgagaaccaggggacgagtgagatcggcaacaacgggtgg
aagctctacttcagcttcgtccggcggatcctctcggagggcgagggagacgacacgggg
atccaggagctcacgaagcagggcgtccgcatcgcactcgcggacaacgccgcgagcggc
gactactacgtgctggagcccatcgacacctttaagccgatcgcccctggcgagaagcgc
gagatcagcgtgctgatcagcgactgggccatcctgaaagcggatgcgcccgccgggttc
cacatcgcgttcgcgggtgaagacttcaagaacgtcgccttcgccgtgccctcgacggtc
aagctggacgcctccgatccgaagcagaccacgcgcttcgagggagacgtgatgcccgtg
cagaccgcctccctgcgctacgacgagaatccttcggcccagagcctggatctcaaggca
cggctcctgcccactccccgccgggtcgaggcgggcgcgggcgaggtgccgctcagcggc
aacgtcttcatcggtcacaccgccaacctgaagggtgaggcggactacctcgcggccgcc
ctgggggatgtgctgaacgcgtccatcaccgcccggccggccgcgggcggcgagcagatc
tccctgagcatcgatcccaacctcgacgtgaccggggacggcgtccgcgatccggagggc
taccagctcgatgtgcgggaagggagcgtgaagatcctcggcgccgacgcctcaggggtg
ttctacggcatccagacgctccgccagctcatctccccccaggcctatcaggcggcgtcg
aagcgcgagggccgcctcacgcagatcgcccttccggaggcccgcatcaccgacgccccg
gggttcgtctatcgcggcatgcacctggatgtggggcgccacttccagtccaaggagacc
gtcaagaagctgctcgatgtgatctcccacttcaagatcaacaagttcaacatccacctg
accgacgacgagggctggcggttggagacgccgggcatccccgagctgacgagctacggc
gcgcgccggggcttcgatctcgcagaggccgagatgctccacgcggggctcggctcaggc
agtgatcttcaggacggagatctcatccgcctcaagccggccacgccgcaaaaggccaac
gcagagacgcctccggcctaccagggcttcgagacggcgacgctcaacttcgtgggcaag
ggaagcggctactacaccaccaaggacttcgaggagatcctcaagtacgccacggaacgg
cacatcgaggtcatccccgagatcgacgtgccgggccacgcccgggccgccgtcaaggcc
atggagtaccgctaccggaagctcaaggacctggatcccgcccaggcggccgcttaccgg
ctgatcgatccgaacgacacctccaagcacaagagcgtccagggctacacggacaacttc
atcaacccgtgcctggacacctcgtacgccttcctgaccaaggtcgccgaggagatcaag
gcacgctacgccgcggcaggcgcgccgctgaagaccatccacgcgggaggcgatgagctg
cccgcgctgaacccgaacgtgtggtggcagggctccccgctctgcaaggccaaccccgcg
accaaggacatggatgaccaccagctcttcaaccacttcttcacgcgctggaatcagatc
atcaaggcgaccggcgcggagatgacgggctgggacgacatcatccacaacgggctcacc
ctgccagggttcatcccgatgccgtggagcaacgtctggggctggggccgcgaggatgac
gcgtacaagtacgccaaccagggctaccaggtcatcctgtcccactcgacgaacctctac
atggacctggcctacaacaaggatcccgacgagccgggctactactgggccaacttcgtc
gacgagaagaagacgttcgagtaccggcccttcgacatctacgccaacgccacccacgac
cggatgggcaacgccatcaagccggaagatctggcgagcaaggtccgcctcacggcggag
ggcaagaagaacatcctcggcatgcacggcctgctctggggcgagaacctgaagacgccc
gaggtggtcgagtacctcgccttcccgaaggtgctcggcgtcgccgagcgcgcgtggaac
ccggagcttccggaggtgagcgcgatgccggccctgtggggccagttcaccaacagcctg
gggcagtatgtgctgccgcgcctgggggcctaccggccggtggatctgcgcgatgagctt
cccgagagcgtgggcgtgaactaccgcatcccactccccggcggccgcctcatcgacggc
aagctgcacgcgaacgtgcgcttcccgggcctcgccatcgagtactcgaccgacgacggc
aggacctggacggcgtacacggagcccgtggcggctccccagaagacgctgctcaggacc
cggacgctcgacggacgcagcagccgcgtcaccgggctcaactaa

DBGET integrated database retrieval system