KEGG   Stigmatella aurantiaca: STAUR_5354Help
Entry
STAUR_5354        CDS       T01425                                 

Definition
glucodextranase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STAUR_5354
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     STAUR_5354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6645566..6647692
Genome map
AA seq 708 aa AA seqDB search
MLLAGLLLVGCASSKRSIAPGHPGAPALWTPANKAGFGTARSAASRVWYTLGSRGDLTEV
YYPTLSTPSVRELRFVVSDGRTFAELESEATEHRVELADPRSLTFRQVNTARSGRYRLTK
TYVTDPERHVVLIGVRFESLSGEPYSLHVVYDPSLSNDGMDDVGTSQEGALLASDGTSAS
ALLAAPALTRTSSGYLGVSDGWSDLQDNFQQDWAYASAAPGNVVQTAQLEVDGRDRQQVT
LALGFGTTPDEARVAARDSLASGFEQVAERYAAGWHGYLDGLPRAPASAQPWQVTYDVSL
MVLAASEDKTYRGAYIASPSMPWVWGTGDLERPSGPYHLVWSRDLYQVATALLAAGDRPG
AERALDHLFQVQQKPDGSFPQNAEVSGKPRWTSLQLDEVALPIVLAWQLGRADAATYTGH
IQKAADFLVANGPVSPQERWENQGGYSPGTIAAEIAGLICAADLARRNRDTASAVRYEST
ADSWQRQVDAWTLTSNGPLAPHPYYLRITKDGNPNAGTSYSLGDGGPAAVDQRHVVDTSF
LELVRLGVKPANHPAIVQTLPVVDAQLQVQTPQGPLWHRYDFDGYGETREGGEWVISEPG
TGQTLGRAWPLFAGERGEYALAAGQPADGYLATMAGSGSEGYMLPEQVWDGRPPTGQPGF
VAGKGTFSATPLTWTHAQFIRLAWSIQVGYPIAQPTVVACRYTGICQR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcggggctgctgctggtgggctgcgccagctccaagcgatcgatcgcccca
ggacaccccggtgcccctgccctctggacccccgcgaacaaggctggcttcggcaccgcg
cgcagcgcggcaagccgggtctggtacacgctgggctcacgcggagacctcacggaagtc
tattacccgaccctcagcaccccgagcgtgagggagctgcgcttcgtggtctccgacggc
cgcaccttcgccgagctggaatccgaggccaccgagcaccgtgtcgagctcgcggaccca
cgcagcctcaccttccgtcaggtgaacacggcccgctccggcaggtaccgcctcaccaag
acctacgtgacggacccagagcggcacgtggtgctcatcggcgtgcgcttcgagtccctc
tccggtgagccctactcgcttcatgtggtgtacgacccgtcgctgtccaacgatgggatg
gatgacgttggcacgagccaggagggtgcgctgctcgcatccgatggaacctccgcgagc
gccctgctggcggcccctgccctgacgcggacatcgagcggctacctgggcgtgagcgat
ggctggagcgatctccaggacaactttcagcaagactgggcgtacgcctcggcggccccc
ggcaacgtggtgcagacggcccagttggaggtggacgggcgagaccgccagcaggtgacg
ctcgcgctcgggtttggcaccaccccagacgaggcccgcgtggccgcccgggattcgctg
gcctcgggcttcgagcaggtggcggagcggtacgccgcgggctggcatggctacctcgac
gggctgccccgcgctccagcgagcgcgcagccgtggcaggtgacctatgacgtctcgctg
atggtgctggcggcctcggaggacaagacctacaggggggcctacattgcctcgcccagc
atgccgtgggtctggggcactggggacctggagcggccctccggcccctaccacctcgtc
tggtcccgcgacctgtatcaggtcgccaccgcgctgctggccgcgggagatcggccgggg
gcggagcgcgcgttggaccatctcttccaggtccagcagaaaccggacggctccttccct
cagaacgccgaggtgagtggaaagccgcgctggaccagcctgcagctcgatgaggtggcg
cttcccatcgtgctggcctggcagctcggccgggccgacgcggcgacgtacaccgggcac
atccagaaggcggcggacttcctggtggccaacggccccgtctccccacaagagcgctgg
gagaaccagggcggctactcacctggaacgatcgcggcggagatcgcggggctcatctgt
gccgccgacctcgcgcgccgcaacagagacaccgcctccgccgtgcgctacgagtccacc
gcggattcctggcagcggcaggtggacgcctggacgctcacgagcaacggcccgctggcg
ccgcatccttattacctgcggatcaccaaggatgggaacccgaatgccggaacctcttac
tcgctgggggatggcggccctgccgccgtggaccaacggcacgtggtggacacgagcttc
ctcgagctggtgcggctgggcgtgaagccggcgaaccacccggccatcgtgcagaccctg
ccggtggtggacgcccagctccaggtccagacgccccaggggccgctctggcaccggtat
gacttcgacggctacggcgagacgcgcgagggcggtgagtgggtgatcagcgagcccggc
accggacaaaccctcgggagggcctggcccctcttcgcgggcgagcggggagagtacgcg
ctcgccgccgggcagcccgcggacgggtatctcgccacgatggcgggctcgggcagcgag
gggtacatgctgcccgagcaggtctgggatgggcggcctcccaccggccagcccggcttc
gtggcgggaaaggggacgttctccgccacccccctcacctggacgcatgcccagttcatt
cgcttggcctggtccatccaggtgggctaccccatcgcgcaacccaccgtggtggcctgc
cgctacacgggcatctgccagcggtag

DBGET integrated database retrieval system