KEGG   Stigmatella aurantiaca: STAUR_5602Help
Entry
STAUR_5602        CDS       T01425                                 

Gene name
cheB1
Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase 1
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sur  Stigmatella aurantiaca
Pathway
sur02020  Two-component system
sur02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sur00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STAUR_5602 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    STAUR_5602 (cheB1)
Enzymes [BR:sur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     STAUR_5602 (cheB1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     STAUR_5602 (cheB1)
Two-component system [BR:sur02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   STAUR_5602 (cheB1)
Bacterial motility proteins [BR:sur02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STAUR_5602 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ADO73367
UniProt: Q08UH0
Position
complement(6923484..6924533)
Genome map
AA seq 349 aa AA seqDB search
MTARAPIRVLVIDDSAQNRRTLTQLLASALDVEVVGEAEHGEEGLRKVLELHPDVVTVDL
EMPRLGGYTFLRLLRGTAPTPVIVISSYSHQTDVFKALELGAFDFIAKPQKATAEALESL
RVELLEKVRASRFARSRSSQREAVQRALGTTEQPPFVVAVAASTGGPPAVQRLLEALAVE
PTPCVLVCQHMPAQFTRAFAERLDRIGPFTVTEAGEGDRLLPGHVYIAPGGRHMVLEERA
GRLELSVPPQGPGDRYAPSADRLFASIARFLGDKSLAVVLTGMGSDGSEGARQIHRAGGE
VWAEAEETAVVFGMPQEVIATGVVRRVLPLGKIGPALVVRARRRRSAPE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcgcgcccccatccgggtgctcgtcatcgacgattcggcacagaaccggcgg
acgctgacccagctgttggcctccgcgctggatgtggaggtcgtgggcgaggcggagcac
ggcgaggaggggctgcgcaaggtgctggagctgcacccggacgtggtgacggtggatctg
gagatgccccggctgggtggctacaccttcctgcggctgctgcgcggcacggcgcccacg
ccggtcatcgtcatctccagctattcccaccagacggacgtcttcaaggcgctggagctg
ggggccttcgacttcatcgccaagccccagaaggccaccgccgaggccctcgagagcctg
cgcgtggaattgctggagaaggtccgggcctcgcggttcgcccgctcgcgaagctcccag
cgcgaggcggtgcagcgggccctgggcaccaccgagcaaccccccttcgtcgtggcggtg
gccgcctccacgggagggcctcccgcggtacagcgcctgctggaggcgctcgcggtggag
cccacgccgtgtgtgctcgtctgtcagcacatgcccgcccagttcacccgggctttcgcg
gagcggttggatcgcatcgggccattcacggtcacggaagccggcgagggagaccgcctc
ctgcccggccacgtctacatcgccccgggaggccggcacatggtgctcgaggagcgggcg
gggcggctggagctgagtgttccgccccaggggccgggggaccggtatgcgccttcggcg
gaccggctcttcgcgagcatcgcgcggttcttgggggacaagtccctggcggtggtgctg
acggggatgggttcggatgggagcgagggggcacggcagatccaccgcgcgggcggagag
gtctgggcggaggccgaggagacggcggtggttttcgggatgcctcaggaagtcatcgcc
accggtgtggtgcggcgggtgcttcccctgggaaagatcggcccggcgctggtggtgcgc
gcccggcgccgccgctcggcgcccgagtga

DBGET integrated database retrieval system