KEGG   Stigmatella aurantiaca: STAUR_5780Help
Entry
STAUR_5780        CDS       T01425                                 

Gene name
ruvA
Definition
holliday junction ATP-dependent DNA helicase ruva (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sur  Stigmatella aurantiaca
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STAUR_5780 (ruvA)
Enzymes [BR:sur01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STAUR_5780 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7128781..7129392)
Genome map
AA seq 203 aa AA seqDB search
MIAALRGTVAEKDLEEAIIDVAGVGYRVAFSTLTLGKLPAEGQPVHVRVRTVVREDAFEL
FGFLSKAEEEMFLLLTSVSHVGPRLALMVLSGMEVAELAVALGKGEIARLTKIHGVGKKT
AERLVLELREKVKELHLEAVAKGASSVSVPAGPKADLVSALLNLGYKAPQAEKAAELAGE
RLGPEAAFQALFREALKVLRSGA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggcactgcgaggaaccgtcgcggagaaggacctggaggaggccatcatcgac
gtcgcgggggtgggctaccgtgtcgccttctccacgctgacgctgggcaagcttcccgcg
gaggggcagcccgtccacgtgcgtgtccgcacggtggtgcgcgaggatgccttcgagctg
ttcggcttcctctcgaaggcggaggaggagatgttccttctgctcacctccgtgtcccac
gtgggcccgcgcctggcgctcatggtgctgtcgggcatggaggtggcggagctggcggtg
gcgctcggcaagggagagattgcccggctcaccaagattcacggcgtggggaagaagacg
gccgagcggctggtgctggagctccgggagaaggtgaaagagcttcacctggaggccgtg
gcgaagggggcctcctcggtcagtgtgccggcgggtccgaaggcagacctcgtctcggcg
ttgctgaacctgggctacaaggcgccgcaggcggagaaggccgcggagctggccggagag
cggctcggccccgaggcggccttccaggccctgttccgcgaggccctcaaggtcctgcgc
tcgggggcctga

DBGET integrated database retrieval system