KEGG   Stigmatella aurantiaca: STAUR_6060Help
Entry
STAUR_6060        CDS       T01425                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sur01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sur00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sur00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7450997..7452154
Genome map
AA seq 385 aa AA seqDB search
MPFSHLTHLSCTKCGKTYDPEALLNVCREPGCAGSLFAEYDVPRLSREDIASRSRTIWRW
HELMPARRPEDIITLGEGGTPLLHARRLGERLSMPDVWVKEEAGNPTGSFKARGLGAAVT
MAKALGARAIALPTAGNAGGAAAAYAAKAGLPCHVFMPKDTPKVFRIECEAYGAQVTLVD
GLIDDCGRIVAQRKEAEGWFDVSTLKEPYRVEGKKTMGYELAEQFGWTLPDVIVYPTGGG
TGLIGMWKAFDEMERLGWIGAKRPRMISVQAEGCAPIPKAFAEGKDVSVRFENAHTYASG
LRVPKAYADYLVLKILRASKGEAVTISDDEMRRGVNELASSEGLYAAPEGGAAWEAVKKL
LAAQKVQRTERVVVFDTGTGYKYID
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttcccacctgacgcacctgtcctgcacgaagtgcgggaagacgtatgaccct
gaggcgctcctcaacgtctgccgggagccggggtgtgcgggctccctcttcgcggagtac
gatgtgccgcggctgtcgcgagaagacatcgcctcacgcagccgaaccatctggcgttgg
cacgagctgatgcccgcccgccgccccgaggacatcatcacgctgggagagggcggaacg
cccctcctgcacgcccgaagactgggcgagcgcctctccatgccggacgtctgggtgaag
gaggaagccggcaatcccaccggctccttcaaggcgcgcggcttgggcgccgcggtgacc
atggccaaggcgctcggcgcgcgcgccatcgccctgccgaccgcgggcaatgcgggaggc
gccgcggcggcctacgcggcgaaggcgggcctgccctgccacgtcttcatgcccaaggac
actccgaaggtcttccgcatcgaatgcgaggcctacggcgctcaggtgacgctcgtggat
gggctcatcgacgactgtggccgcatcgtcgcgcagcgcaaggaggccgaaggctggttc
gatgtctcgacgctgaaggagccgtaccgcgtcgagggaaagaagacgatggggtacgag
ctggccgagcagttcgggtggacgctgccagacgtcatcgtctaccccaccgggggaggc
acggggctgatcggcatgtggaaggccttcgatgagatggagcgactcggctggattggc
gcgaagcgcccacggatgatctccgtgcaagccgaggggtgcgcaccgattccgaaggcc
ttcgcggaaggaaaggacgtctcggtgcgcttcgagaacgcccacacctatgccagtggc
ttgcgtgtccccaaggcgtatgcggactacctcgtcctgaagatcctgcgcgcctcgaag
ggcgaggcggtgaccatctccgatgacgagatgcgccggggggtgaacgagctggcctcc
agcgaagggctctatgccgcccccgagggcggcgccgcgtgggaagccgtgaagaagctg
ctcgccgcgcagaaagtccagcgcacggagcgggtggtcgtcttcgacacggggactggg
tacaagtacatcgactga

DBGET integrated database retrieval system