KEGG   Stigmatella aurantiaca: STAUR_6060Help
Entry
STAUR_6060        CDS       T01425                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_6060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_6060
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STAUR_6060
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STAUR_6060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7450997..7452154
Genome map
AA seq 385 aa AA seqDB search
MPFSHLTHLSCTKCGKTYDPEALLNVCREPGCAGSLFAEYDVPRLSREDIASRSRTIWRW
HELMPARRPEDIITLGEGGTPLLHARRLGERLSMPDVWVKEEAGNPTGSFKARGLGAAVT
MAKALGARAIALPTAGNAGGAAAAYAAKAGLPCHVFMPKDTPKVFRIECEAYGAQVTLVD
GLIDDCGRIVAQRKEAEGWFDVSTLKEPYRVEGKKTMGYELAEQFGWTLPDVIVYPTGGG
TGLIGMWKAFDEMERLGWIGAKRPRMISVQAEGCAPIPKAFAEGKDVSVRFENAHTYASG
LRVPKAYADYLVLKILRASKGEAVTISDDEMRRGVNELASSEGLYAAPEGGAAWEAVKKL
LAAQKVQRTERVVVFDTGTGYKYID
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttcccacctgacgcacctgtcctgcacgaagtgcgggaagacgtatgaccct
gaggcgctcctcaacgtctgccgggagccggggtgtgcgggctccctcttcgcggagtac
gatgtgccgcggctgtcgcgagaagacatcgcctcacgcagccgaaccatctggcgttgg
cacgagctgatgcccgcccgccgccccgaggacatcatcacgctgggagagggcggaacg
cccctcctgcacgcccgaagactgggcgagcgcctctccatgccggacgtctgggtgaag
gaggaagccggcaatcccaccggctccttcaaggcgcgcggcttgggcgccgcggtgacc
atggccaaggcgctcggcgcgcgcgccatcgccctgccgaccgcgggcaatgcgggaggc
gccgcggcggcctacgcggcgaaggcgggcctgccctgccacgtcttcatgcccaaggac
actccgaaggtcttccgcatcgaatgcgaggcctacggcgctcaggtgacgctcgtggat
gggctcatcgacgactgtggccgcatcgtcgcgcagcgcaaggaggccgaaggctggttc
gatgtctcgacgctgaaggagccgtaccgcgtcgagggaaagaagacgatggggtacgag
ctggccgagcagttcgggtggacgctgccagacgtcatcgtctaccccaccgggggaggc
acggggctgatcggcatgtggaaggccttcgatgagatggagcgactcggctggattggc
gcgaagcgcccacggatgatctccgtgcaagccgaggggtgcgcaccgattccgaaggcc
ttcgcggaaggaaaggacgtctcggtgcgcttcgagaacgcccacacctatgccagtggc
ttgcgtgtccccaaggcgtatgcggactacctcgtcctgaagatcctgcgcgcctcgaag
ggcgaggcggtgaccatctccgatgacgagatgcgccggggggtgaacgagctggcctcc
agcgaagggctctatgccgcccccgagggcggcgccgcgtgggaagccgtgaagaagctg
ctcgccgcgcagaaagtccagcgcacggagcgggtggtcgtcttcgacacggggactggg
tacaagtacatcgactga

DBGET integrated database retrieval system