KEGG   Stigmatella aurantiaca: STAUR_6081Help
Entry
STAUR_6081        CDS       T01425                                 

Gene name
fadJ
Definition
Fatty oxidation complex subunit alpha FadJ
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_6081 (fadJ)
   01212 Fatty acid metabolism
    STAUR_6081 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STAUR_6081 (fadJ)
   00650 Butanoate metabolism
    STAUR_6081 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_6081 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    STAUR_6081 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAUR_6081 (fadJ)
   00310 Lysine degradation
    STAUR_6081 (fadJ)
   00380 Tryptophan metabolism
    STAUR_6081 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_6081 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STAUR_6081 (fadJ)
   00281 Geraniol degradation
    STAUR_6081 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    STAUR_6081 (fadJ)
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STAUR_6081 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STAUR_6081 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STAUR_6081 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7477356..7479590)
Genome map
AA seq 744 aa AA seqDB search
MAIKLEELEVKHGFSYQVEDGIAVFTFDLPDSAVNTLSPETGLAFDALLDRAEQASEVRA
VVFTSGKKDNFVAGAKIDFLQKIKTAEEAATVARNAQKGFDRLDGFPKPVVAAIHGSCLG
GGLEWALACDYRIITDSPKTVLGLPEVQLGLLPGGGGTQRLPALIGVQAALDLILTGKHV
KPSKAKRLGLVDEVVPVSLLRPLAVRRARELADGTLKVERAHGQGLKAVATQSKKGLAGF
FKSLANKEMWAEVALEDNPLGRKLLFDQARKQLLKKTRGHYPAQEKALEAVRTGVTAGRQ
AGLEAEARLFGELVVSDVSQRLVELFFATTALKKENGTSNPSVKAREIKKVGVLGGGLMG
GGIAYVSSALQGVPVRVKDKDDLGAGRALKQIQGILDERVKKRSLTSRESAAKMALVSAG
TDYSGFKTVDLVIEAVFEDLKLKQRVLAETEAVTHDGCIFASNTSSLPITELAKGSRRPE
LVIGMHYFSPVHKMPLLEIITHPGTAEWVTATCVEVGRKQGKTVIVVNDGVGFYTSRALA
PYMNEAAYLLAEGADIAELDKALVEFGFPVGPITLLDEVGIDVAHKVGPIMEAAFGKRLA
APKTLDKVIEDGRLGRKNQKGFYTYNGKKKEVDASVYALLPAGQDRKDFDLAEMAERCVL
QMVNEAVRCLGEGILRSPRDGDVGAIFGLGFPPFRGGPFRYADRLTPAVLLKRLEHYQDK
FGERFTPAPFLVETVKEGKTFHAR
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaaactggaagagctcgaggtgaagcacggcttctcctaccaggtcgaggat
ggcatcgcggtcttcaccttcgacctgccggactcggcggtgaacaccctctcgccggag
accggcctcgcgttcgatgcgctgctcgatcgcgcggagcaggcctcggaggtgagggcg
gtggttttcacctcaggaaagaaggacaatttcgtggctggggcgaagatcgacttcctc
cagaagatcaagacggccgaagaggccgccaccgttgcccggaatgcccagaagggtttc
gatcggttggatggctttcccaagcccgtggtggcggccatccatggctcgtgccttggc
ggcggcctggagtgggcgctggcgtgtgattaccgcatcatcaccgacagcccgaagacg
gtgctgggcttgcccgaggtgcagctcggcctgctgcctggtgggggcgggacccagcgg
ctccccgcgctcattggtgtccaggccgcgctggacctcatcctcaccggcaagcacgtg
aagccatcgaaggcgaagcggttgggtctggtggatgaagtggtgccggtgtccttgctg
cgccccttggcggtacggcgcgcgcgcgaactggccgatgggacgctgaaggtggagcgc
gctcacggccagggcctcaaagcggtggccacgcagtccaagaagggattggcggggttt
ttcaagagcctggccaacaaggagatgtgggctgaggtcgccctcgaggacaaccctctc
ggccggaagcttctcttcgatcaggcgcgcaagcagctcttgaagaagacgcgtggccac
tatcctgcccaggagaaggcactggaagccgtgcgcacgggcgtgactgccggccgtcag
gcaggcttggaggccgaggcgcgtctctttggcgaactggtggtgtcggacgtctcccag
cggctggtggagctcttcttcgccaccacggcgctcaagaaggagaacggcacctctaac
ccgagcgtgaaagcccgggagatcaagaaggtgggcgtgctggggggcgggctcatgggc
ggcggcatcgcctacgtgtcttcggcgctccagggggtaccggtgcgcgtgaaggacaag
gatgacctgggcgccgggcgcgccctcaagcagatccaaggcatcctggacgagcgcgtg
aagaagcggtccctgacctcgcgggaatcggccgcgaagatggccctggtctccgcggga
accgactacagcggcttcaagaccgtggacctcgtcatcgaggccgtgttcgaggatttg
aaactcaagcagcgcgtgctggccgagacggaggcggtgacccacgacgggtgcatcttt
gcctccaacacctccagcctgcccatcacggagctggccaaggggagtcggcggcccgag
ttggtcatcgggatgcattacttcagcccggtgcacaagatgcctctgctggagatcatt
acccacccggggaccgccgagtgggtgacggccacctgtgtggaggtgggccggaagcag
ggcaagacggtcatcgtcgtcaacgatggggtgggcttctacacatcgcgcgccctcgcc
ccgtacatgaacgaggcggcgtatctgctggccgagggcgcggacattgccgagttggac
aaggcgctcgtggagttcggcttcccggtcgggcccatcaccttgttggacgaggtcggc
atcgacgtcgcgcacaaggtgggtcccatcatggaggccgccttcggcaagcggctggcg
gccccgaagacgctcgacaaggtcatcgaggacgggcgcctcgggcgcaagaaccagaag
ggcttctacacctacaacgggaagaagaaggaggtggatgcctccgtctacgcgctgctc
ccggcgggacaggaccgcaaggacttcgatctcgccgaaatggcggagcggtgcgtcctg
cagatggtcaacgaggcggtgcgctgcctgggcgagggcatcctccgcagcccgagggat
ggagatgtgggcgccatcttcggattgggcttcccgccgttccgcggaggccccttccgg
tatgcggaccgcttgacacccgccgtgctgctcaagcgcttggagcactaccaggacaaa
ttcggtgagcgcttcacccccgcgcccttcctggtggagacggtgaaggaggggaagacc
ttccacgcgcgttag

DBGET integrated database retrieval system