KEGG   Stigmatella aurantiaca: STAUR_6601Help
Entry
STAUR_6601        CDS       T01425                                 

Gene name
mutM
Definition
DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sur  Stigmatella aurantiaca
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sur03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8086307..8087152)
Genome map
AA seq 281 aa AA seqDB search
MPELPEVEIARRNLVRWIGPRRVVKAEADDTRVFRGAERARFSALKGRVESLERRGKYLL
WTFEAGRGLLAHLGMTGKFVRRQKGQPEPYSRARFHLEDGTVIHFRDPRLFGRMEPVPAS
ELRALEAIQSLGRDPLEDGLTGPQLAEAVGTSRQDLKVALMDQGRLAGLGNIHAAEALFR
AGLHPARKPDTLTPEDWKRLARAIHATIAFGLEEQEGEEPVYLEDGGAENVFRVYGRAGQ
PCQVCQSPVESFTQAGRTTHVCPECQPLKAQRPGRKRAPGR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctcccagaggtagagatcgcccggcggaacctggtacgttggattggcccg
cgccgcgtggtgaaggccgaggcggacgacacccgggttttccgaggggcggagcgtgcg
cggttctccgcgctcaaggggcgggtcgagtccctggagcgccggggcaagtacctgctg
tggaccttcgaggcgggccgcggcctgctggcccacctggggatgaccggaaagttcgtt
cgccggcaaaaagggcagccagagccctacagccgcgcccgcttccacctggaggatggc
accgtcatccacttccgtgacccgcgcctctttgggcggatggagcccgtgcccgcctcg
gaactccgggcgttggaggccatccagtcgctgggaagggatccgctggaggatggactg
acggggccgcagctcgcggaggcggtgggcacctcccggcaggacctgaaggtggcgctg
atggaccaggggcgcctcgcgggcctgggcaacatccacgccgccgaggcgctcttccgc
gcgggcctgcacccggcgcgcaagcccgacaccctcaccccggaggactggaagcggctg
gcgcgggccatccacgcgaccatcgccttcggcctggaggagcaggagggggaagaaccg
gtttacctggaggatgggggggccgagaacgtgttccgggtgtatggccgggcgggccag
ccctgtcaggtgtgccagtccccggtggagtccttcacccaggcgggccgcaccacgcac
gtctgtccggagtgccagccgttgaaggcgcaacgcccggggcggaagcgggcgccgggg
cgttga

DBGET integrated database retrieval system