KEGG   Stigmatella aurantiaca: STAUR_6761Help
Entry
STAUR_6761        CDS       T01425                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_6761 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_6761 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STAUR_6761 (trpB)
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STAUR_6761 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8281018..8282232
Genome map
AA seq 404 aa AA seqDB search
MSIETSATIGRFGPFGGRYVPETLVPALLELEEAYTAARADPAFGKQVAQVLKEFVGRET
PLTPAHRLTAAWGGAQVWLKREDLAHTGAHKINNTIGQVLLALRMGKKRIIAETGAGQHG
VATATACALFGLPCEVYMGALDVERQALNVFRMRALGATVRPVELGSKTLKDAMNEAMRT
WVSQVQDTHYVIGSAAGPHPYPTIVRDFQAIIGQEVRKQSQALFGQLPDAIIACVGGGSN
AIGVLHPFVGDKQVRLVGVEAGGHGLHTKQHGASLTLGTEGVLHGSRSLVLQDEHGQIQE
AHSISAGLDYPGVGPELAFLVKTGRMEIRTATDDEALQAFYEVSRSEGILPALETSHAFA
RGAELARELGKGKHLVINCSGRGDKDVATIAARGIPAAITGNKS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagacttcggccaccattggccgctttggccccttcggcggccgctatgtg
ccggagacgctcgtcccggccttgctggagttggaagaggcctacaccgcggcccgggcg
gacccggccttcggcaagcaggtcgcccaggtcctcaaggagttcgtgggccgggagacg
ccgctgacgcccgcgcaccggctcaccgcggcctggggcggcgcgcaggtgtggctcaag
cgggaggatctggcgcacacgggtgcgcacaagatcaacaacaccatcggccaggtgctg
ctggcactgcggatgggcaagaagcgcatcatcgcggagacgggcgcgggccagcatggc
gtggccacggccaccgcgtgcgcgctcttcgggctgccgtgcgaggtgtacatgggcgcg
ctggacgtggagcgccaggcgctcaacgtcttccgcatgcgcgccctgggcgccacggtc
cgtccggtggagctgggctcgaagacgctgaaggatgcgatgaacgaggccatgcgcacc
tgggtctcccaggtccaggacacgcactacgtcatcggcagcgcggcggggcctcacccc
taccccaccatcgtccgggacttccaagccatcatcggccaggaggtgcggaagcaatcc
caggccctctttggacagctgccggatgccatcatcgcctgcgtgggcggcggctcgaac
gccatcggcgtgctccaccccttcgtcggcgacaagcaggtgcggctggtgggcgtcgag
gccggaggccacggcctgcacaccaagcagcacggcgcgtcgctgacgctcggcacggaa
ggggtgctccacggctcgcgctcgctggtgctccaggatgagcacgggcagatccaggag
gcccactccatctccgccggtctggactacccgggcgtggggccggagctggccttcctg
gtgaagacgggccgcatggagatccgcacggcgacggatgacgaggcgcttcaggccttc
tacgaggtgtcgcgctccgagggcatcctgccggcgctggagacgtcccatgccttcgcg
cgcggggcggagctggcgcgcgagctgggcaagggcaagcacctggtcatcaactgttcg
ggccgcggcgacaaggacgtggccaccatcgcggcccggggcatccccgcggccatcacg
gggaacaagtcatga

DBGET integrated database retrieval system