KEGG   Stigmatella aurantiaca: STAUR_6762Help
Entry
STAUR_6762        CDS       T01425                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STAUR_6762 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STAUR_6762 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STAUR_6762 (trpA)
Enzymes [BR:sur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STAUR_6762 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
8282229..8283020
Genome map
AA seq 263 aa AA seqDB search
MSGEIAAAFAKAKARGEGALVAYAMAGDPDLPRSVDVFAAMVEGGADILEIGVAFSDPIA
DGPVIQEASERALKAGASLKRVLNEVVPEVRKRCPETPLVVMTYINVVMAMGEEKYAKLA
REKGISGTILPDLPPEESSGIRATFDAAGLDLIPLCAPTTPPARAEAIARDARGFVYCVS
VAGVTGMRSELPVDLSSRLELVRKASPVPITAGFGISTAEQARTIGAHADGVVVGSALVR
AAHADGPAAARQLCAEIKRGLKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagagatcgcggcggcctttgcaaaggcgaaggcccggggcgaaggcgcgctg
gtggcgtacgccatggccggggatccggatctgccccgctcggtggacgtcttcgcggcg
atggtggaaggcggcgcggacatcctggagatcggcgtggcgttcagcgatcccatcgcg
gacgggcccgtcatccaggaggcctcggagcgagcgctcaaggccggtgcttcgctgaag
cgcgtgctgaacgaggtggtgcccgaggtgcgcaagcgctgccccgagacgccgctcgtg
gtgatgacgtacatcaacgtggtgatggcgatgggcgaggagaagtacgcgaagctggcg
cgcgagaagggcatctccggcaccatccttccggacctgcccccggaagagagctcgggg
atccgcgcgaccttcgacgcggcggggctggacctcatcccgctgtgcgcgccgaccacg
cctccggcacgcgccgaggcgattgcccgggatgcccgtggcttcgtgtactgcgtgtcc
gtggcgggtgtgacgggcatgcgctccgagctgccggtggacctgtcctcgcggctcgag
ctggtgaggaaggcatcgccggtgcccatcacggctggctttggcatctccaccgccgag
caagcgcgcaccattggcgcacacgcggatggcgtggtggtgggcagcgccctcgtgcgt
gccgcccatgcggacggcccagcggcggcacgtcagctctgcgcggagatcaaacgcgga
ctgaagcgctga

DBGET integrated database retrieval system