KEGG   Stigmatella aurantiaca: STAUR_6866Help
Entry
STAUR_6866        CDS       T01425                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sur  Stigmatella aurantiaca
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sur01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sur01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8387854..8388858
Genome map
AA seq 334 aa AA seqDB search
MKTDTPALAPDDKINWLASIPFLGIHAMCLFVLSVGAKPVDVLVCLALYVIRMWGVTAGY
HRYFSHRAYKTNRVFQFILALVATSSAQKGVLWWAANHRHHHRESDTELDIHSPLHKGFW
WSHMGWIMCPKYEQTRFEAIKDFARFPELRFLNRFFLLPPIALAVALYFIGGFSMLVWGF
FVSTTLLYHGTFTINSLSHIFGNRRYRTTDTSKNNWLLALITLGEGWHNNHHYYQNTANQ
GWFWWEVDISYYSLKVLSWMRVVSDLRTPSDQVKYAYKKYTPEMQAELKASTDFWGAVSS
RKKAAEDKVREALEAAADHLPTSAPAPQALLKRQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaccgacacccctgccctggcccccgacgataagatcaactggctggcctccatc
cccttcctgggcatccacgcgatgtgcctctttgtcctctctgtgggggcgaagcccgtg
gatgtgctggtgtgcctggccctctacgtgattcgcatgtggggcgtcaccgcgggctac
caccgctacttcagccaccgggcctacaagacgaaccgcgtcttccagttcatcctcgcc
ctggtggcgacgtcgtccgcccagaagggcgtgctgtggtgggccgccaaccaccggcac
caccaccgggagtcggacacggagctggacatccactcgccgctccacaagggcttctgg
tggagccacatgggctggatcatgtgcccgaagtacgagcagacgcgcttcgaggccatc
aaggatttcgcgcgcttcccggagctgcgcttcctcaaccgcttcttcctgctgccgccc
atcgcgctggccgtggcgctgtacttcatcggtggcttctcgatgctcgtctggggcttc
ttcgtgagcaccacgctgctgtaccacggcaccttcaccatcaactcgctgagccacatc
ttcggcaaccgccgctaccgcaccacggacaccagcaagaacaactggctcctggcgctc
atcaccctgggcgaggggtggcacaacaaccaccactactaccagaacaccgccaaccag
ggctggttctggtgggaagtcgacatcagctactactcgctgaaggtgctctcctggatg
cgcgtggtgagcgatctgcgcacgccctcggaccaggtgaagtacgcctacaagaagtac
acccccgagatgcaggcggagctgaaggcctccacggacttctggggcgccgtgtcctcc
cggaagaaggcggcggaggacaaggtgcgcgaggccctggaggccgcggcggaccacctg
ccgacctccgcgcccgccccgcaggccctgctcaagcggcagtag

DBGET integrated database retrieval system