KEGG   Stigmatella aurantiaca: STAUR_7015Help
Entry
STAUR_7015        CDS       T01425                                 

Definition
endo-1,4-beta-xylanase b
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sur  Stigmatella aurantiaca
Brite
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     STAUR_7015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8580574..8582079
Genome map
AA seq 501 aa AA seqDB search
MSRPLPLLVTLCLAACGGPEGLPDTAFPDTVGVSPAEAVAVGGGLKTLAATHGITFGGVA
KRSAIDNDAAFRTTLTREFNLVTPENELKMKFIQPNRKDEFLWGDADALVNYARSNGLAL
HGHTLVWYKVPTWVESTALSEREAVMKNFITTVATRYKGKVWAWDVVNEVFNDDGSYRNS
VWYQAMGTGFIDKAFWTARTADPAAKLVYNDYGIETINAKSNAVYAMIQGLIAKGVPFDG
LAFQMHIKQKGIDYQSFADNMRRFAALGIQLYVSEMDVATNSHPATPADLTAQADVYWNI
LDRVLQQPAVKAFQLWGVTDKYTWLPENDPLIFDAAYNAKPAYAALEHRLQTGGFSGRYT
LVNKRTGKALHVAGSAQTNAAAVVQYELHEDWAAQQWSFNYVGGRSYQVLNHHSALALKV
KDGSTLEGALLEQYTPDVSMDSEQWELISAGNGYHALRNKRSQRLLVAFPGDNNTPVHQY
SPYVPTAEFTDSQLWTLRRVP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccccctgcccctgctcgtcacgctctgccttgcggcctgcggagggcccgag
ggtctcccggacacggccttcccggacacggtgggcgtgagccccgcggaagcggtggcg
gtggggggagggctcaagacgctggccgccacccatggcatcacctttggaggggtggcc
aagcgctcggcgatcgacaacgacgccgccttccggaccacgttgacgcgcgagttcaac
ctggtcacccccgagaacgagctgaagatgaagttcatccagcccaaccggaaggacgag
ttcctctggggggacgccgatgcgctggtgaactacgccaggagcaacggcctggccctg
catggccacaccctcgtctggtacaaggttcccacctgggtcgagagcaccgcgctcagc
gagcgcgaggcggtgatgaagaacttcatcaccacggtggccacccgctacaagggcaag
gtctgggcgtgggatgtggtcaacgaggtcttcaacgacgatggctcgtaccgcaactcc
gtctggtaccaggccatgggcacgggcttcatcgacaaggcgttctggacggcgcgcacc
gcggacccggccgccaagctcgtctacaacgactatggcatcgagaccatcaacgccaag
tcgaacgccgtctacgcgatgatccagggcttgatcgccaagggcgtgcccttcgatggg
ctcgccttccagatgcacatcaagcagaagggcatcgactaccagagcttcgcggacaac
atgcggcgcttcgcggcgctgggcatccagctctacgtcagcgagatggacgtcgcgacc
aacagccacccggccaccccggcggacctgacggcccaggcggacgtctactggaacatc
ctcgaccgggtgctccagcagcccgccgtcaaggcgttccagctctggggggtgaccgac
aagtacacctggctgccggagaacgaccccctcatcttcgacgcggcctacaacgcgaag
cccgcctacgcggcgctggagcaccggctccagaccggaggcttctcgggccgctacacg
ctggtgaacaagcggaccggcaaggccctgcacgtggccggcagcgcgcagaccaacgcg
gccgcggtggtgcagtacgagcttcacgaggactgggccgcccagcagtggagcttcaac
tacgtgggaggccgctcctaccaggtcctcaaccaccacagcgcgctggcgctgaaggtc
aaggatggctccaccttggaaggggcgctgctcgagcagtacacccccgatgtgtcgatg
gacagcgagcagtgggagctcatctccgcgggcaacggctaccatgccctgcgcaacaag
cgcagccagcgcctgctggtggccttccccggggacaacaacaccccggtccaccagtac
agcccctacgtgcccacggcggagttcaccgacagccagctctggaccctgcgccgcgtg
ccgtga

DBGET integrated database retrieval system