KEGG   Stigmatella aurantiaca: STAUR_7196Help
Entry
STAUR_7196        CDS       T01425                                 

Gene name
mls
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sur  Stigmatella aurantiaca
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STAUR_7196 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    STAUR_7196 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    STAUR_7196 (mls)
Enzymes [BR:sur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     STAUR_7196 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8815667..8817286
Genome map
AA seq 539 aa AA seqDB search
MREPVSSPKPPAFGPGVVLHGAWSPDYAPVLTPEALEFVAKLVRAFGETREVLLAQRQER
QRAFQRGERPHFLPETKAIREGDWKAAPLPKDLLDRRVEITGPVDRKMIINALNSGANVF
MADFEDSNSPTWDNVVRGQLNLMDAVRGTITYTAENGKHYALHEKPAVLFVRPRGWHLPE
RHLEVDGKPVPGSLFDFGLFFFHNAKAQLARGTGPYFYLPKLESHREARLWNDVFLLAQR
ELGLPTGTLKATVLIETLPAAFEMEEILYELREHSAGLNCGRWDYIFSFIKKLQADPAFL
LPDRGQVTMDKAFLDAYSRRLIQTCHRRGVHAMGGMAAFIPIKGDAAANEAVLAKVRADK
LREVKNGHDGTWVAHPGLVSVAREVFDAHMKGPNQLGTLRQDVKVGEAELLAVPSGTRTE
EGLRHNIRVGVQYMAAWMGGSGCVPLYNLMEDAATAEISRAQVWQWIHHGATLEDGRKLT
PELFRQVYAEEMARLEKAGALADSGPAAQARELFERLSTAPTFEDFLTLPAYEALSPRS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagcctgtgtcctctcccaagccgcctgccttcggtcccggagtggtgttgcat
ggggcctggtcccctgactacgcccccgtgttgaccccggaagcactggaattcgtggcc
aagctcgtccgggccttcggggagacgcgtgaggtcctgctggcccagcgccaggagcgc
caacgggcctttcagcggggcgagcggccccacttcctccccgagacgaaggccatccgt
gagggggactggaaagccgcccccctgcccaaggatctcttggaccggcgcgtggagatc
accggcccggtggaccggaagatgatcatcaacgcgctcaactcgggcgccaacgtcttc
atggcggacttcgaggactcgaacagccccacctgggacaacgtggtgcgcggccagctc
aacctgatggacgccgtgcgcggcaccatcacctatacggccgaaaacggaaagcactac
gccctgcacgagaagcccgccgtgctcttcgtccgcccgcgcggctggcacctcccggag
cgccacctcgaggtggacggcaagcccgtgcccggctccctgttcgacttcggcctcttc
ttcttccacaacgcgaaggcgcagctcgcgcgcggcaccggcccctacttctacctgccc
aagctggagagccaccgggaggcccggctgtggaatgacgtgttcctcctggcgcagcgg
gagctggggctgcccaccggcaccctcaaggccacggtgctcatcgagacgctgccggcg
gccttcgagatggaggagatcctctacgagctgcgcgagcactcggccgggctcaactgc
ggccgctgggactacatcttcagcttcatcaagaagctccaggcggacccggccttcctg
ctgcccgaccgggggcaggtgaccatggacaaggcgttcctggatgcctactcgcgccgg
ctcatccagacgtgccaccgccggggggtccacgccatgggcggcatggcggcgttcatc
cccatcaagggggatgcggccgccaacgaggcggtgctcgccaaggtgcgcgccgacaag
ctgcgcgaggtgaagaacggccacgacggcacgtgggtggcccacccgggcctggtgtcc
gtggcgcgcgaggtgttcgacgcgcacatgaaggggccgaaccagctcggcaccctgcgc
caggatgtgaaggtgggcgaggcggagctgctcgccgtcccctcgggcacccgcaccgag
gaggggctgcgccacaacatccgcgtgggcgtgcagtacatggccgcctggatgggcggc
tcgggctgcgtgccgctctacaacctcatggaggacgcggccacggcggagatctcccgc
gcgcaggtgtggcagtggatccaccacggcgccacgctggaggatgggcgcaagctcacc
ccggagctgttccggcaggtgtacgccgaggagatggcccgcctggagaaggcgggcgcc
ctggcggacagcggccccgcggcgcaggcgcgtgagcttttcgagcggctgtccaccgcg
cccaccttcgaggacttcctcaccctgccggcctacgaggccctgagccctcggtcctga

DBGET integrated database retrieval system