KEGG   Stigmatella aurantiaca: STAUR_7259Help
Entry
STAUR_7259        CDS       T01425                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00052  Galactose metabolism
sur00500  Starch and sucrose metabolism
sur00520  Amino sugar and nucleotide sugar metabolism
sur00521  Streptomycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
sur01200  Carbon metabolism
Module
sur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7259 (glcK)
   00052 Galactose metabolism
    STAUR_7259 (glcK)
   00500 Starch and sucrose metabolism
    STAUR_7259 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_7259 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STAUR_7259 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    STAUR_7259 (glcK)
Enzymes [BR:sur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STAUR_7259 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ADO75015
UniProt: Q08WY0
Position
complement(8894487..8895416)
Genome map
AA seq 309 aa AA seqDB search
MPTLGIDLGGTNARAAVVDERGQILAAAKMALTERSPAAVVESIAQAAAEAVALAGVKVA
GCGVGAAGQIPGDSGVLAVAPNLGWRNVPLGGLLRERLGLPVRLVNDLAAAAWGEFNAGA
GRGAQDVYVSFVGSGVGSCIIANGQLVRGAGGVAGELGHTKVIPGGRRCGCGELGCLEAY
SGGHNLIALTQELLASGRSSVLNELTAGVAERITPLTLERAAEAGDPGAVEIHARAGKML
GTAIANMVTVLNPARLILGGGVLMNCPGLRRYVVEAVQSQTSNTAREGLLIAEAELGDDS
GLIGAALLG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctgggaatcgatctgggaggaaccaacgcccgcgccgccgtggtggatgag
cgagggcagattctcgccgccgccaagatggcgctcaccgagcgcagtcccgcggcggtg
gtggagtccatcgctcaagccgccgccgaggccgtggccctggcgggggtcaaggtcgcg
gggtgtggcgtcggggccgcggggcagattcccggcgactcgggcgtgctcgccgtggcg
cccaacctgggctggcgcaacgtgccgctggggggcctgttgagggagcggctcgggctg
ccggtgcggctggtgaatgacctggccgccgccgcctggggcgagttcaacgccggcgcc
gggcggggcgcccaggacgtgtatgtgtccttcgtgggctcaggggtgggcagctgcatc
atcgccaacgggcagctcgtccgcggcgcgggtggggtggcgggcgagctggggcacacc
aaggtgattcccggcggccggcgctgtggctgcggcgagctggggtgcctggaggcctac
tcgggcgggcacaacctcatcgccctgacgcaggagctgctcgcctcgggccgctcctcc
gtcctgaacgagctgaccgcgggcgtggccgagcgcatcaccccgttgacgctggagcgg
gcggcggaggcgggcgacccgggcgcggtggagatccacgcgcgggccgggaagatgctg
ggcacggccattgccaacatggtgacggtgctcaacccggcccggctcatcctgggcgga
ggggtgctgatgaactgccccggcctgcgccgctacgtggtggaggccgtccagtcgcag
acctcgaacaccgcgcgcgaggggttgctcatcgccgaggccgagctgggagacgacagc
ggcctcatcggcgcggcgttgctgggttga

DBGET integrated database retrieval system