KEGG   Stigmatella aurantiaca: STAUR_7260Help
Entry
STAUR_7260        CDS       T01425                                 

Gene name
algC
Definition
(GenBank) Phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sur  Stigmatella aurantiaca
Pathway
sur00010  Glycolysis / Gluconeogenesis
sur00030  Pentose phosphate pathway
sur00051  Fructose and mannose metabolism
sur00052  Galactose metabolism
sur00230  Purine metabolism
sur00500  Starch and sucrose metabolism
sur00520  Amino sugar and nucleotide sugar metabolism
sur00521  Streptomycin biosynthesis
sur01100  Metabolic pathways
sur01110  Biosynthesis of secondary metabolites
sur01120  Microbial metabolism in diverse environments
sur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7260 (algC)
   00030 Pentose phosphate pathway
    STAUR_7260 (algC)
   00051 Fructose and mannose metabolism
    STAUR_7260 (algC)
   00052 Galactose metabolism
    STAUR_7260 (algC)
   00500 Starch and sucrose metabolism
    STAUR_7260 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_7260 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    STAUR_7260 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STAUR_7260 (algC)
Enzymes [BR:sur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     STAUR_7260 (algC)
    5.4.2.8  phosphomannomutase
     STAUR_7260 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ADO75016
UniProt: Q08WX9
Position
complement(8895466..8896836)
Genome map
AA seq 456 aa AA seqDB search
MNTHIFREYDIRGLVDKDLTEEVVELLGKGLGSAIRRQDGRSIAVGRDCRESSTRFRDAL
CRGLTSTGLHVLDVGVVPTPLTYFAANTLPVDGLAMITGSHNPPEYNGFKIGVGKTTFHG
PEIQALRQSIERRDFVVGHTPGTVTPYDIITPYNHFIQQTVKVGRKGMRIVIDAGNGTGG
AVAVPLFRAMGFDVVPLFCEMDATFPNHHPDPTVVENLEDLIAAVKREKAEVGIAYDGDS
DRIGVIDDQGNILWGDQLMVLFSRYVLKESPGAAIVGEVKCSYTLYDDIAKHGGKPVMWK
AGHSLIKAKMKETHAELAGEMSGHIFFKNRYFGFDDAVYSSARLLEILTHEPRKLSELLA
DVPKTYASPELRVDTREEKKFELVRRATDTLRAAGHDIVDVDGVRVTFPDGWGLIRASNT
QPILVLRFEASTPERLQEIQQLIEGTVARVKREAGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcacatttttcgcgagtacgacatccgtggcttggtggacaaggatctcacc
gaagaggtggtggagctgctgggcaagggcctggggtccgccatccgccgccaggatggg
cgctccattgccgtggggcgcgactgccgcgagtcctccacccggttccgggatgcactg
tgccgcggattgacgtcgacgggcctccacgtgctggatgtgggcgttgtgcccacgccg
ctgacctacttcgccgccaacacgctgccggtggatggcctggcgatgatcaccggcagc
cacaacccgcccgagtacaacggcttcaagattggcgtggggaagacgacctttcacggc
ccggagatccaggcgctgcgccagagcatcgagcgccgtgacttcgtggtgggccacacg
ccgggcaccgtgacgccctacgacatcatcaccccctacaaccacttcatccagcagacg
gtgaaggtgggccgcaaggggatgcgcattgtcatcgacgcgggcaatggcaccgggggc
gccgtggcggtgccgctgttccgggccatgggcttcgatgtggtgcccctgttctgcgag
atggacgccaccttccccaaccaccacccggaccccaccgtggtggagaacctcgaggac
ctgatcgccgcggtgaagcgcgagaaggccgaggtgggcattgcctacgacggcgacagc
gaccgcattggcgtcatcgatgaccagggcaacattctctggggcgatcagctcatggtg
ctcttcagccgctatgtgctgaaggagagcccgggcgcggccatcgtcggcgaggtgaag
tgcagctacacgctctatgacgacatcgccaagcacggcggcaagccggtgatgtggaag
gcgggccactcgctcatcaaggcgaagatgaaggagacgcacgccgagctggccggagag
atgagcggccacatcttcttcaagaaccgctacttcggcttcgatgacgcggtgtactcg
tcggcccgcctgctggagatcctcacccacgagccgcgcaagctctcggagttgctcgcg
gatgtgcccaagacctacgcctcgcccgagctgcgcgtggacacccgcgaggagaagaag
ttcgagctggtgcggcgggccacggacacgctgcgcgccgcgggccatgacatcgtggac
gtggatggggtgcgcgtgacgttcccggacgggtggggcctcatccgggcctccaacacc
cagcccatcctcgtgctgcgcttcgaggcgagcacgccggagcggctccaggagattcag
cagctcatcgaggggaccgtggcgcgcgtcaagcgcgaggcgggggcctga

DBGET integrated database retrieval system