KEGG   Stigmatella aurantiaca: STAUR_7260Help
Entry
STAUR_7260        CDS       T01425                                 

Gene name
algC
Definition
phosphomannomutase/phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7260 (algC)
   00030 Pentose phosphate pathway
    STAUR_7260 (algC)
   00051 Fructose and mannose metabolism
    STAUR_7260 (algC)
   00052 Galactose metabolism
    STAUR_7260 (algC)
   00500 Starch and sucrose metabolism
    STAUR_7260 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    STAUR_7260 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    STAUR_7260 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STAUR_7260 (algC)
Enzymes [BR:sur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     STAUR_7260 (algC)
    5.4.2.8  phosphomannomutase
     STAUR_7260 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8895466..8896836)
Genome map
AA seq 456 aa AA seqDB search
MNTHIFREYDIRGLVDKDLTEEVVELLGKGLGSAIRRQDGRSIAVGRDCRESSTRFRDAL
CRGLTSTGLHVLDVGVVPTPLTYFAANTLPVDGLAMITGSHNPPEYNGFKIGVGKTTFHG
PEIQALRQSIERRDFVVGHTPGTVTPYDIITPYNHFIQQTVKVGRKGMRIVIDAGNGTGG
AVAVPLFRAMGFDVVPLFCEMDATFPNHHPDPTVVENLEDLIAAVKREKAEVGIAYDGDS
DRIGVIDDQGNILWGDQLMVLFSRYVLKESPGAAIVGEVKCSYTLYDDIAKHGGKPVMWK
AGHSLIKAKMKETHAELAGEMSGHIFFKNRYFGFDDAVYSSARLLEILTHEPRKLSELLA
DVPKTYASPELRVDTREEKKFELVRRATDTLRAAGHDIVDVDGVRVTFPDGWGLIRASNT
QPILVLRFEASTPERLQEIQQLIEGTVARVKREAGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcacatttttcgcgagtacgacatccgtggcttggtggacaaggatctcacc
gaagaggtggtggagctgctgggcaagggcctggggtccgccatccgccgccaggatggg
cgctccattgccgtggggcgcgactgccgcgagtcctccacccggttccgggatgcactg
tgccgcggattgacgtcgacgggcctccacgtgctggatgtgggcgttgtgcccacgccg
ctgacctacttcgccgccaacacgctgccggtggatggcctggcgatgatcaccggcagc
cacaacccgcccgagtacaacggcttcaagattggcgtggggaagacgacctttcacggc
ccggagatccaggcgctgcgccagagcatcgagcgccgtgacttcgtggtgggccacacg
ccgggcaccgtgacgccctacgacatcatcaccccctacaaccacttcatccagcagacg
gtgaaggtgggccgcaaggggatgcgcattgtcatcgacgcgggcaatggcaccgggggc
gccgtggcggtgccgctgttccgggccatgggcttcgatgtggtgcccctgttctgcgag
atggacgccaccttccccaaccaccacccggaccccaccgtggtggagaacctcgaggac
ctgatcgccgcggtgaagcgcgagaaggccgaggtgggcattgcctacgacggcgacagc
gaccgcattggcgtcatcgatgaccagggcaacattctctggggcgatcagctcatggtg
ctcttcagccgctatgtgctgaaggagagcccgggcgcggccatcgtcggcgaggtgaag
tgcagctacacgctctatgacgacatcgccaagcacggcggcaagccggtgatgtggaag
gcgggccactcgctcatcaaggcgaagatgaaggagacgcacgccgagctggccggagag
atgagcggccacatcttcttcaagaaccgctacttcggcttcgatgacgcggtgtactcg
tcggcccgcctgctggagatcctcacccacgagccgcgcaagctctcggagttgctcgcg
gatgtgcccaagacctacgcctcgcccgagctgcgcgtggacacccgcgaggagaagaag
ttcgagctggtgcggcgggccacggacacgctgcgcgccgcgggccatgacatcgtggac
gtggatggggtgcgcgtgacgttcccggacgggtggggcctcatccgggcctccaacacc
cagcccatcctcgtgctgcgcttcgaggcgagcacgccggagcggctccaggagattcag
cagctcatcgaggggaccgtggcgcgcgtcaagcgcgaggcgggggcctga

DBGET integrated database retrieval system