KEGG   Stigmatella aurantiaca: STAUR_7318Help
Entry
STAUR_7318        CDS       T01425                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sur  Stigmatella aurantiaca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STAUR_7318
Enzymes [BR:sur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     STAUR_7318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8977653..8979155
Genome map
AA seq 500 aa AA seqDB search
MHPRGILRPRSFRSLCSLSLTLASSWVLACGPAPEEGAPLTAQSAAPLASAAPQPTALTE
LVTNGTFASGAVAPWWNNAPTQVRVENGRLRVDVASGTANLWDAIIGQSGIPLVSGKAYT
LSFSASASASLSVRTTVQQEPAPYTAVLTQQFSIDGTSRRFSFPFTSSLGTPQGQVTFQL
GGRSAATTVFLDDISLTTEGGSGGSGPLGMTSGFYVDSETEAARWVRANGGDSRAVRIQS
SIASKPSARWFGNWSGNITSAVSSYVAAADAADKLPVLVAYNIPGRDCGSHSGGGAGSPE
AYRTWISAFAAAIGNRPAIVIIEPDAVAQLDCLANDSERQVRLGLLRYATEQLRDRATNT
WTYLDGGNAQWIAADTMAQRLESAGVKNIRGFALNVSNFYTTAQSNPYGASVNSALSSRY
GYTRQFVVDTSRNGNGSNGEWCNPGGRKLGSPSQVGTGTGAELLLWVKSPGESDGNCGIA
PGASAGQFSPDLAIRLIDGT
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgcatccccgtggaatccttcgtccccgttccttccggagcctctgctccctgtcgctg
acgctcgcctcgagctgggtactggcctgtggccccgcccccgaggagggcgcgcccctc
acggcccagtcggccgcgcccctcgcctccgccgcaccccagcccaccgccctcaccgag
ctcgtcaccaacggcacctttgccagtggcgcggtcgccccctggtggaacaacgcccca
acccaggtgcgcgtcgagaacggccgcttgcgcgtcgacgtcgcctcgggcaccgccaac
ctctgggacgccatcatcggccagagcggcattcccctggtgagcggcaaggcgtacacg
ctgtccttctcggcctcggcctcggccagcctctccgtgcgcacgacggtgcagcaggaa
cccgcgccctacacggcggtgctgacccagcagttctcgatcgacggcacctcccggagg
ttctcgttcccgttcacctcctccttgggcacgccccagggccaggtcaccttccagctc
ggaggccgctccgcggcgaccaccgtcttcctcgatgacatctccctgaccacggagggc
gggagcggaggctcgggccccctgggcatgaccagcggcttctacgtggattcggagacc
gaggccgcgcgctgggtgcgcgcgaatggcggggactcgcgcgcggtgcgcatccaatcg
tccatcgcgagcaagccgagcgcgcgctggttcggcaactggagcgggaacatcacctcg
gcggtgtcgagctacgtcgccgcggccgatgccgccgacaagctgccggtgctcgtggcc
tacaacatccctggccgcgactgcggcagccactcggggggcggagcagggagccccgag
gcttaccggacgtggatctccgccttcgcggcggcgatcggcaaccggcccgcgatcgtc
atcatcgagccggatgcggtggcccaactcgactgcctggcgaacgactccgagcggcag
gtgcgattgggcctgctgcgctacgccaccgagcaactgcgcgaccgggccacgaacacg
tggacgtacctcgacggcgggaatgcccaatggattgccgccgacacgatggcgcagcgg
ctcgagtccgccggggtgaagaacatccggggcttcgcgctcaacgtgtcgaacttctac
accacggcccagtcgaacccgtacggcgcatcggtcaacagcgcgctgtccagccgctac
ggctacacgcggcagttcgtggtggacaccagccgcaatggcaacggctccaacggcgag
tggtgcaacccaggcgggcgcaagctgggctccccctcccaggtgggaaccggcaccggg
gccgagctgctgctgtgggtgaagtcccccggcgagtcggacggaaactgcggcatcgcc
ccgggcgcctccgccgggcagttcagcccggacctggcgatccggctcatcgacggcacg
tga

DBGET integrated database retrieval system