KEGG   Stigmatella aurantiaca: STAUR_7562Help
Entry
STAUR_7562        CDS       T01425                                 

Definition
Methylase of chemotaxis methyl-accepting protein, CheR-type
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sur  Stigmatella aurantiaca
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sur00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STAUR_7562
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    STAUR_7562
Enzymes [BR:sur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     STAUR_7562
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     STAUR_7562
Two-component system [BR:sur02022]
 CheA family
  CheA-CheYBV
   STAUR_7562
Bacterial motility proteins [BR:sur02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STAUR_7562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9255780..9257732
Genome map
AA seq 650 aa AA seqDB search
MASKPPRDSELEAILEKVRQVRSFDFRSYKRATLQRRIERRMAATRCQTRTAYLALLDRD
ANEVNTLVSSMLIKLTTFFRDPEVWTSLEKVVREMTLKRQPDQELRIWSAGCATGEEAYS
IAILAAEALGPGMPGAELKVFGTDVDEAAIAFARRGVYTPQQLEGCSKERLARWFVPSGG
GYAVRKEIRRAVVFGVNNLVSDAPVSRIDLILCRNVFIYLDAELQKRSLARFHFALRHDG
VLALGRSELIPFAAKLFEPVELTRRIYRKDGRQELSWAPQERGISSSEPTGTGRPPLDAQ
SPRDAQRALLREVLDSQPCPLIATDNEGTVIVFNQAAAHLWGRTEAEVAGKRLAALALPG
LSQDLLVEQSARVKAGRSAREVGDGTLKVPGTDPVVIRTLVVPLRSLSAENAGLLYVAHD
VTALRSLEQHLQQANEELNTANLRLQSSNEEMRASNEELETTNEELQSANEELQTTNEEL
QSTNEELETTNEELQSTNAELDATNRELAHRTQEMDALSFSQHAIIRALSEGVMVLDANG
YITAWNLAAERLLGLTERETVGQVLWTLRIPALNRALLNRVRKHLTANRTLRQEDVSYQL
PHGGRGRATLVATPLIMDSQVLGAIILLEDTTRLSTLAQKNREMKERMKA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaagcccccccgcgacagcgaattagaagccatcctcgaaaaggtgcggcag
gtccggagcttcgacttccgcagctacaagcgggccacgctccagcgccgcatcgagcgg
cgcatggccgccacgcgctgtcagacccggaccgcgtacctggccctgctcgatcgggat
gcgaacgaggtgaacaccctcgtctcctccatgctcatcaagctgaccaccttcttccgg
gacccggaggtgtggacctcgctcgagaaggtggtgcgggaaatgacgctcaagcgccaa
cccgatcaggagctgcgcatctggagcgcggggtgcgccaccggcgaggaggcctattcg
attgccatcctcgccgcggaggccttgggccccggcatgcccggcgcggagctgaaggtg
tttggcacggatgtggacgaggcggccattgccttcgcgcgccgcggcgtctacaccccc
cagcagctcgagggctgctccaaggaacggctggcgcgctggttcgtcccctccggcggg
gggtatgcggtgcgcaaggagatccgccgcgcggtcgtcttcggggtcaacaacctcgtc
tccgacgcgcccgtctcgcggatcgatctcatcctctgccgcaacgtcttcatctacctg
gacgcggaactccagaagcgctccctggcgcgcttccacttcgccttgcgccacgacggc
gtcctggccctggggcgctcggagctcatccccttcgcggccaagctcttcgagccggtg
gagctgacccggcgcatctaccgcaaggatgggcggcaggagctgtcctgggcgccccag
gagcgggggatttcctcgagcgagcccaccgggactgggcggccccccctggacgcgcag
tccccccgggacgcgcagcgggccctgctgcgcgaggtgctcgactcgcaaccctgcccg
ctcatcgccacggacaacgaagggaccgtcatcgtcttcaatcaggccgccgcgcatctg
tggggccgcaccgaggcggaggtcgccggcaaacgcctggcggccttggcgctgcccggg
ctcagccaggacctgctggtggagcagagcgcccgcgtgaaggccggccggtccgcgcgg
gaagtgggcgacggcaccctgaaggtcccgggcacggacccggtggttatccggaccctg
gtcgtccccttgcgctccctctcggccgagaacgccggcctgctgtacgtggcgcacgat
gtgacggcgctgcggagcctggagcaacacctccagcaagccaacgaggagctgaacacc
gccaacctccggctccaatcctccaacgaggagatgcgcgcctccaacgaggagctcgag
acgaccaacgaggagctccagagcgccaacgaggagctccagacgaccaacgaggagctt
cagtccaccaacgaggagctcgagacgaccaacgaggagcttcagtccaccaacgccgag
ctggacgccaccaaccgggagttggcccaccgcacccaggagatggatgcgctgagcttc
tcccagcacgccatcatccgtgccctctccgagggggtgatggtgctggatgccaacggc
tacatcaccgcgtggaaccttgccgccgagcggctgctgggcctcaccgagcgagaaacg
gtgggccaagtgctgtggaccctgcgcatcccagccctcaaccgggccctgctcaaccgc
gtccgcaagcacctgacggccaaccggaccttgcgccaggaggatgtcagctatcagctt
ccccatggcggacggggccgcgccaccttggtggccacccccctcattatggattcccag
gtcctcggggctatcatcctcctcgaggacactacccggctgagcacgctcgcccagaag
aaccgggaaatgaaggagcgcatgaaggcatga

DBGET integrated database retrieval system