KEGG   Stigmatella aurantiaca: STAUR_7660Help
Entry
STAUR_7660        CDS       T01425                                 

Gene name
xynZ
Definition
endo-1,4-beta-xylanase z (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sur  Stigmatella aurantiaca
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9381076..9382704
Genome map
AA seq 542 aa AA seqDB search
MTLVFMGCGSGNTSDPGAPLDSTAPFVTIQAPTPSAQVSGVLGVLGTASDDVAVGSVEVQ
VDQAPFAPTSGTTEWSYLWNTASLSDGLHALTVRVTDTSGNVGLTSITVHVNNSTGGTPL
PVVMALTVSPNGGVIGDMLRASAAFTNPGAQPLRLSRLRLTARAPGGTLAEATEVDFEPA
LGPLTLAPGETVRLEALGRPLATAPTGDWQVLPSADEEGGLTHFGAPQTVTLRRQVRLGA
ATHQKRLFDAGEPVYQQTFLSHFDSLTPEYEMKIAQLQPTQGHFDFAIADQIVAFAEANG
KQVRGHTLIWGNSLPAWLTERSWTREELIQVLETYIATVVGRYRGRITEWDVVNEAFLDD
GTWRQNLWWTTIGPEYIALAFQAAHRADPSAKLFYNDYSIERINSKSNAILTLATSLIAQ
GVPIDGIGMQAHVSPNYYPTQAQLEAVLSRLEAAGLEGQLTELDVNLTKLADTPGAEKFE
LQAQIYQGMVAACQARPGCTRITTWGITDKYTYLGSTGAPLLFDTQYGPKRAMEVTRRTL
GR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcgtcttcatgggctgtgggtctggaaacacctcggatccgggcgctcccctg
gactcgaccgcgcccttcgtcaccatccaggcccccacccccagtgcccaggtcagcggc
gtgctgggcgtgctgggcaccgcctcggatgatgtcgccgtgggctccgtcgaggtgcag
gtggaccaggcgcccttcgcccccacctccggcaccaccgagtggagctacctctggaac
accgcctccctgagcgacggcctccatgcactcaccgtccgcgtcacggacacctccggc
aacgtcggcctcacctccatcacggtgcacgtgaacaattcgactgggggcactccgctc
ccggtggtgatggcgctcaccgtctcgccgaacggcggggtcatcggggacatgctccgg
gcctcggccgccttcaccaaccccggcgctcagcccctgcggctgtcccggctgcggctc
accgcgcgtgctcccggaggaaccctcgcggaggccaccgaggtggacttcgagcccgcg
ctcggccccctcacgctggcgcccggggagacggtgcggctggaggccctgggccggccc
ctcgccacggcccccacaggggactggcaggtcctgcccagcgcggacgaggagggcggc
ctcacgcacttcggcgccccccagaccgtgaccctccggcgtcaggtgcgcctgggcgcc
gccacccaccagaagcgtctcttcgatgcgggcgagccggtctaccagcagaccttcctg
tctcacttcgactcgctgacgcccgagtacgagatgaagatcgcccagctccaacccacc
cagggccacttcgacttcgccatcgccgatcagatcgtcgccttcgccgaggcgaacgga
aagcaggtccggggccacacgctcatctggggcaactcgctccccgcctggctcaccgag
cgctcgtggacgcgcgaagagctcatccaggtgctcgagacctacatcgccaccgtggtg
gggcgctaccggggccgcatcaccgagtgggacgtcgtgaacgaggccttcctcgatgat
ggcacctggcggcagaacctctggtggaccaccatcggcccggagtacatcgcgctggcc
ttccaggccgcccaccgcgccgacccttccgccaagctcttctacaacgactacagcatc
gagcggatcaactcgaagtccaacgccatcctcaccctggccacctcgctcatcgcccag
ggcgtccccatcgatggcatcgggatgcaggcgcacgtctcgcccaactactaccccacc
caggcccagctcgaggccgtgctctcccggctggaggccgcggggctggagggccagctg
accgagctggacgtcaacctcaccaagctcgcggacacccccggcgcggagaagttcgag
ctccaggcgcagatctaccaaggcatggtggccgcctgtcaggcccgccccggctgcacc
cgcatcaccacgtggggcatcaccgacaagtacacctacctgggcagcaccggggcgccc
ctcctctttgacacccagtatgggcccaagcgcgccatggaggtgactcgccgcaccctg
gggcgctga

DBGET integrated database retrieval system