KEGG   Stigmatella aurantiaca: STAUR_7781Help
Entry
STAUR_7781        CDS       T01425                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7781
   00040 Pentose and glucuronate interconversions
    STAUR_7781
   00053 Ascorbate and aldarate metabolism
    STAUR_7781
   00620 Pyruvate metabolism
    STAUR_7781
   00640 Propanoate metabolism
    STAUR_7781
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_7781
   00561 Glycerolipid metabolism
    STAUR_7781
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAUR_7781
   00310 Lysine degradation
    STAUR_7781
   00330 Arginine and proline metabolism
    STAUR_7781
   00340 Histidine metabolism
    STAUR_7781
   00380 Tryptophan metabolism
    STAUR_7781
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_7781
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STAUR_7781
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STAUR_7781
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     STAUR_7781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9515875..9517317
Genome map
AA seq 480 aa AA seqDB search
MRLVVTEEAVDTHQPLREAFERLQSRRWEMAQTGAPERLARLARLKTNLLARREALAEAM
FADFRKPRAEVESTEVLPVLLELAHTARHLKAWMKPRRVGAPVLLAGTRSEVHSEPKGVV
LVLSPWNYPFCLAINPLIAALAAGNCVMLKPSEKTPRTAAFLEALVRDTFEPSEVTVVQG
GPDVGDALLQLPFDHFFFTGGSRVGQKVMAAAARHLAGVTLELGGKSPVIVDATADVKAA
AERIIWGKFVNAGQTCIAPDHVYVHASREEELLAGMKEALERFYGKTEEARRASPDLCRM
VDDAAFARVRGLLDRTVQAGARLVAGGGVDAASRYIAPTLLADVTARSPVMEEEIFGPLL
PVLRYERVETLVESLRADGKPLALYLFSQDDAAVEYLLKRTSAGGTVVNNVLLQVANPHL
PFGGVGQSGLGAYHGEEGFRELSHARAVLWQGRASLAHFFFPPYTGKAQQLARLASRMFE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtggtcacggaagaagcggtggatacccatcagccgctgcgggaggctttc
gagcggcttcagtcccgtcgctgggaaatggcccagacgggcgctccggaacggctggcc
cggctggcccggctgaagacgaacctcctggcccggcgcgaggcgctcgccgaggccatg
ttcgcggacttccgcaagccgcgcgcggaggtggagagcaccgaggtgctgcccgtgctg
ctggagctggcgcacaccgcgcggcacctgaaggcgtggatgaaaccgcggcgggtcgga
gcccccgtgctgctcgcgggcacgcgcagcgaggtgcactccgagcccaagggcgtggtg
ctggtcctctcgccgtggaattaccccttctgcttggccatcaacccgctcatcgccgcg
ctggccgcgggcaactgcgtgatgctcaagcccagcgagaagacgccccgcaccgccgcg
ttcctggaagcgctggtgcgcgacaccttcgagccctccgaagtcacggtggtgcagggc
ggtccggacgtgggagacgcgctgttgcagctgcccttcgaccacttcttcttcacgggc
ggaagccgcgtgggccaaaaggtgatggcggcggcggcccggcacctggccggggtgacg
ctggagttgggcggcaagtcgccggtcatcgtcgatgccacggcggacgtgaaagccgcg
gcggagcgcatcatctggggcaagttcgtcaacgccgggcagacgtgtatcgcgccggac
cacgtctacgtgcacgcctcgcgcgaggaggagctgctcgccgggatgaaggaggcgctg
gagcgcttctacggcaagacggaggaagcgcggcgggccagcccggacctgtgccggatg
gtggacgacgcggccttcgcccgggtgcgcggactgctggaccggacggtgcaggccggg
gcgcggctggtggccggcggcggggtggacgcggcgagccggtacatcgcccccacgctg
ctcgcggacgtgacggcgcgctcacccgtgatggaggaggagatcttcgggcccctgctc
ccggtgctgcgctacgagcgggtggagacgctggtggagagcctccgcgcggacggcaag
cccttggcgctgtacctcttcagccaggacgacgccgcggtggagtacttgctgaagcgc
acgagcgcgggggggacggtggtgaacaacgtcctcttgcaggtcgccaacccccacctg
cccttcgggggcgtgggccagagcggcctgggcgcctaccacggcgaggaaggcttccgg
gagctgagccacgcgcgggccgtgctctggcagggccgcgcctcgctcgcgcacttcttc
ttccctccctacaccggcaaggcccagcagctcgcacgcctcgccagccgcatgttcgag
tag

DBGET integrated database retrieval system