KEGG   Stigmatella aurantiaca: STAUR_7781Help
Entry
STAUR_7781        CDS       T01425                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sur00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sur00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:sur00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sur00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sur00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sur00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sur00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sur00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sur00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sur00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sur00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sur00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sur00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:sur00903]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sur00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9515875..9517317
Genome map
AA seq 480 aa AA seqDB search
MRLVVTEEAVDTHQPLREAFERLQSRRWEMAQTGAPERLARLARLKTNLLARREALAEAM
FADFRKPRAEVESTEVLPVLLELAHTARHLKAWMKPRRVGAPVLLAGTRSEVHSEPKGVV
LVLSPWNYPFCLAINPLIAALAAGNCVMLKPSEKTPRTAAFLEALVRDTFEPSEVTVVQG
GPDVGDALLQLPFDHFFFTGGSRVGQKVMAAAARHLAGVTLELGGKSPVIVDATADVKAA
AERIIWGKFVNAGQTCIAPDHVYVHASREEELLAGMKEALERFYGKTEEARRASPDLCRM
VDDAAFARVRGLLDRTVQAGARLVAGGGVDAASRYIAPTLLADVTARSPVMEEEIFGPLL
PVLRYERVETLVESLRADGKPLALYLFSQDDAAVEYLLKRTSAGGTVVNNVLLQVANPHL
PFGGVGQSGLGAYHGEEGFRELSHARAVLWQGRASLAHFFFPPYTGKAQQLARLASRMFE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtggtcacggaagaagcggtggatacccatcagccgctgcgggaggctttc
gagcggcttcagtcccgtcgctgggaaatggcccagacgggcgctccggaacggctggcc
cggctggcccggctgaagacgaacctcctggcccggcgcgaggcgctcgccgaggccatg
ttcgcggacttccgcaagccgcgcgcggaggtggagagcaccgaggtgctgcccgtgctg
ctggagctggcgcacaccgcgcggcacctgaaggcgtggatgaaaccgcggcgggtcgga
gcccccgtgctgctcgcgggcacgcgcagcgaggtgcactccgagcccaagggcgtggtg
ctggtcctctcgccgtggaattaccccttctgcttggccatcaacccgctcatcgccgcg
ctggccgcgggcaactgcgtgatgctcaagcccagcgagaagacgccccgcaccgccgcg
ttcctggaagcgctggtgcgcgacaccttcgagccctccgaagtcacggtggtgcagggc
ggtccggacgtgggagacgcgctgttgcagctgcccttcgaccacttcttcttcacgggc
ggaagccgcgtgggccaaaaggtgatggcggcggcggcccggcacctggccggggtgacg
ctggagttgggcggcaagtcgccggtcatcgtcgatgccacggcggacgtgaaagccgcg
gcggagcgcatcatctggggcaagttcgtcaacgccgggcagacgtgtatcgcgccggac
cacgtctacgtgcacgcctcgcgcgaggaggagctgctcgccgggatgaaggaggcgctg
gagcgcttctacggcaagacggaggaagcgcggcgggccagcccggacctgtgccggatg
gtggacgacgcggccttcgcccgggtgcgcggactgctggaccggacggtgcaggccggg
gcgcggctggtggccggcggcggggtggacgcggcgagccggtacatcgcccccacgctg
ctcgcggacgtgacggcgcgctcacccgtgatggaggaggagatcttcgggcccctgctc
ccggtgctgcgctacgagcgggtggagacgctggtggagagcctccgcgcggacggcaag
cccttggcgctgtacctcttcagccaggacgacgccgcggtggagtacttgctgaagcgc
acgagcgcgggggggacggtggtgaacaacgtcctcttgcaggtcgccaacccccacctg
cccttcgggggcgtgggccagagcggcctgggcgcctaccacggcgaggaaggcttccgg
gagctgagccacgcgcgggccgtgctctggcagggccgcgcctcgctcgcgcacttcttc
ttccctccctacaccggcaaggcccagcagctcgcacgcctcgccagccgcatgttcgag
tag

DBGET integrated database retrieval system