KEGG   Stigmatella aurantiaca: STAUR_7781Help
Entry
STAUR_7781        CDS       T01425                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sur  Stigmatella aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STAUR_7781
   00040 Pentose and glucuronate interconversions
    STAUR_7781
   00053 Ascorbate and aldarate metabolism
    STAUR_7781
   00620 Pyruvate metabolism
    STAUR_7781
  Lipid metabolism
   00071 Fatty acid degradation
    STAUR_7781
   00561 Glycerolipid metabolism
    STAUR_7781
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAUR_7781
   00310 Lysine degradation
    STAUR_7781
   00330 Arginine and proline metabolism
    STAUR_7781
   00340 Histidine metabolism
    STAUR_7781
   00380 Tryptophan metabolism
    STAUR_7781
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STAUR_7781
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STAUR_7781
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STAUR_7781
Enzymes [BR:sur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     STAUR_7781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9515875..9517317
Genome map
AA seq 480 aa AA seqDB search
MRLVVTEEAVDTHQPLREAFERLQSRRWEMAQTGAPERLARLARLKTNLLARREALAEAM
FADFRKPRAEVESTEVLPVLLELAHTARHLKAWMKPRRVGAPVLLAGTRSEVHSEPKGVV
LVLSPWNYPFCLAINPLIAALAAGNCVMLKPSEKTPRTAAFLEALVRDTFEPSEVTVVQG
GPDVGDALLQLPFDHFFFTGGSRVGQKVMAAAARHLAGVTLELGGKSPVIVDATADVKAA
AERIIWGKFVNAGQTCIAPDHVYVHASREEELLAGMKEALERFYGKTEEARRASPDLCRM
VDDAAFARVRGLLDRTVQAGARLVAGGGVDAASRYIAPTLLADVTARSPVMEEEIFGPLL
PVLRYERVETLVESLRADGKPLALYLFSQDDAAVEYLLKRTSAGGTVVNNVLLQVANPHL
PFGGVGQSGLGAYHGEEGFRELSHARAVLWQGRASLAHFFFPPYTGKAQQLARLASRMFE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtggtcacggaagaagcggtggatacccatcagccgctgcgggaggctttc
gagcggcttcagtcccgtcgctgggaaatggcccagacgggcgctccggaacggctggcc
cggctggcccggctgaagacgaacctcctggcccggcgcgaggcgctcgccgaggccatg
ttcgcggacttccgcaagccgcgcgcggaggtggagagcaccgaggtgctgcccgtgctg
ctggagctggcgcacaccgcgcggcacctgaaggcgtggatgaaaccgcggcgggtcgga
gcccccgtgctgctcgcgggcacgcgcagcgaggtgcactccgagcccaagggcgtggtg
ctggtcctctcgccgtggaattaccccttctgcttggccatcaacccgctcatcgccgcg
ctggccgcgggcaactgcgtgatgctcaagcccagcgagaagacgccccgcaccgccgcg
ttcctggaagcgctggtgcgcgacaccttcgagccctccgaagtcacggtggtgcagggc
ggtccggacgtgggagacgcgctgttgcagctgcccttcgaccacttcttcttcacgggc
ggaagccgcgtgggccaaaaggtgatggcggcggcggcccggcacctggccggggtgacg
ctggagttgggcggcaagtcgccggtcatcgtcgatgccacggcggacgtgaaagccgcg
gcggagcgcatcatctggggcaagttcgtcaacgccgggcagacgtgtatcgcgccggac
cacgtctacgtgcacgcctcgcgcgaggaggagctgctcgccgggatgaaggaggcgctg
gagcgcttctacggcaagacggaggaagcgcggcgggccagcccggacctgtgccggatg
gtggacgacgcggccttcgcccgggtgcgcggactgctggaccggacggtgcaggccggg
gcgcggctggtggccggcggcggggtggacgcggcgagccggtacatcgcccccacgctg
ctcgcggacgtgacggcgcgctcacccgtgatggaggaggagatcttcgggcccctgctc
ccggtgctgcgctacgagcgggtggagacgctggtggagagcctccgcgcggacggcaag
cccttggcgctgtacctcttcagccaggacgacgccgcggtggagtacttgctgaagcgc
acgagcgcgggggggacggtggtgaacaacgtcctcttgcaggtcgccaacccccacctg
cccttcgggggcgtgggccagagcggcctgggcgcctaccacggcgaggaaggcttccgg
gagctgagccacgcgcgggccgtgctctggcagggccgcgcctcgctcgcgcacttcttc
ttccctccctacaccggcaaggcccagcagctcgcacgcctcgccagccgcatgttcgag
tag

DBGET integrated database retrieval system