KEGG   Stigmatella aurantiaca: STAUR_8049Help
Entry
STAUR_8049        CDS       T01425                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sur  Stigmatella aurantiaca
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sur00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sur00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9852609..9853154)
Genome map
AA seq 181 aa AA seqDB search
MTSSLYDIPLTSIAGKPASLGDYRGKVLLVVNVASKCGLTPQYTGLEALYREKHGAGLEV
LGFPANDFKEQEPGTDAEIQQFCSLNYGVSFPLFSKISVAGSTTHPLYQTLIGAQPAATG
EGPMRERLRGYGIAVNPAPGVAWNFEKFLVGRDGRVVGRFAPDVTVEDPRLRQAIDAALA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacctcttctctctacgacattcccctgacctccattgcgggcaagcccgcctcgctg
ggggactaccgcggcaaggtcttgctggtggtcaatgtggcctccaagtgtggtctgacg
ccgcagtacacggggctggaggcgctgtaccgcgagaagcacggcgcggggctggaggta
ctgggtttcccggccaatgacttcaaggagcaggagccgggcacggacgcggagatccaa
cagttctgcagcctgaactacggcgtgagcttcccgttgttttccaagatcagcgtggcg
gggagcaccacccatccgctgtatcagacgctgatcggcgcccagccggcggccaccggc
gaaggcccgatgcgtgagcggctgcgaggctatggcattgcggtcaacccggctcctggg
gtggcgtggaatttcgagaagttcctcgtgggccgcgacggccgcgtggtgggccgtttt
gccccggacgtgaccgtcgaggatccgcgcttgcgccaggcgattgacgccgcgctggcc
gcctga

DBGET integrated database retrieval system