KEGG   Stigmatella aurantiaca: STAUR_8247Help
Entry
STAUR_8247        CDS       T01425                                 

Definition
phosphoketolase 2-like protein (EC:4.1.2.-)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sur  Stigmatella aurantiaca
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sur00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10076462..10078822
Genome map
AA seq 786 aa AA seqDB search
MSGPLSEEELGKIDAYWRAANYLSVGQIYLKNNPLLERPLTLEDIKPRLLGHFGTTPGLN
FIYVHLNRIIRLHQANMMYLIGPGHGAPGIIANTFLEGSYTETYPNIERNADGLKRLFRQ
FSWPYGVPSHDAPEVPGSISEGGELGYSLLHAYGAAFDNPGLIVACVVGDGEAETGPLAA
SWHSNKFLNPITDGAVLPILHLNGYKIANPTLLARIDPDELDALFRGYGYRPYFLEGDDP
RTMHQQMAAVLDTLYAEIRALQHQAREQKDPSRPRWPMLILKTPKGWTCPRTVDGKPVEG
TWRAHQVPLSEVHSNPEHLRLLEEWLRSYRPQELFDAHGTFREALADIAPKGRLRMGANL
HANGGKLLVPLVLPNFRDYAVPLDVPGSVQLSATQVLGGYLRDVMRKNLGANNFRMFAPD
ENASNRLQAVYEASGKRWNARYEDVDESLSTEGRVMEVLSEHLCQGWLEGYLLTGRHGFF
SCYEAFIHLIDSMFNQHAKWIKSAKELPWRAPIASLNYLLSSHVWRQDHNGFSHQDPGFI
DHVANKKADTVRIYLPPDANTLLSVTDHCLRSKNYVNLIIAGKQAAPVWLDRESAVRHCA
AGIGTWDWASHGEGEPDVVMACAGDVPTLETLAAVTVLREWAPELKVRVINVVDLFTLET
VGEHPHGLNHEDFNRLFTLDKPVIFAFHGYPTIVHKLTYKRVNHGNIHVHGYKEEGTTTT
PFDMTVLNDMDRYTLALDAIRQAPAARHRLDAAEQRYSEVSQRHKLYVSEHGEDMPEVKG
WKWTAR
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtccgctgagcgaagaggagctggggaagatcgacgcctattggcgcgccgcc
aactacctgtccgtggggcagatctacctcaagaacaacccgctgctcgagcggcccctc
accctcgaggacatcaagccccgcttgctgggccacttcggcacgacgcccgggttgaac
ttcatctatgtgcacctgaaccgcatcatccgcctgcatcaggccaacatgatgtatttg
attggccccggccatggcgcccccggcatcatcgccaacaccttcctggaaggctcctat
acggagacctatcccaacatcgagcgcaacgccgatgggctcaaacggctgttccgccag
ttctcctggccctatggcgtccccagtcacgatgctcccgaggtcccgggctccatcagc
gagggcggtgagctgggctactccctgcttcacgcctatggcgccgcctttgacaacccg
ggcctcatcgtcgcctgtgtcgtcggagatggtgaagccgagacaggcccccttgccgcg
agctggcactccaacaagttcctcaaccccatcaccgatggggccgtgctccccatcctc
cacctcaacggctacaagatcgccaaccccaccctgctcgcgcgcatcgaccccgatgaa
ctcgacgccctcttccggggctatggctatcgcccctatttcctcgaaggcgatgacccc
cggacgatgcaccaacagatggccgcggtgctcgataccctctatgccgagatccgcgcc
ctccagcaccaggcccgcgagcagaaggatccgtcccgccctcgctggccgatgctgatc
ctcaagacccccaaggggtggacctgccctcgcaccgtcgacggcaagcccgtcgagggc
acctggcgcgcccatcaggttccgctctcggaggtgcactcgaaccccgagcacctccgg
ctcctcgaagagtggctgcgcagctaccggccccaggagctgttcgacgcccacggcacc
ttccgggaagcgctggcggacatcgctcccaagggccgcctgcgcatgggcgccaacctt
cacgccaatggcggcaagctcctggtgcccctcgtcctgccgaacttccgtgactacgcg
gtgcccctcgacgtgccgggctcggtccagctgagcgccacccaggtgctgggcggctac
ctgcgcgacgtcatgcgcaagaacctcggggcgaacaacttccgcatgttcgcccccgac
gagaacgcctccaaccggctccaggccgtctacgaggccagcggcaagcggtggaacgcc
cgctacgaagacgtggatgagtccctctccaccgaaggccgcgtgatggaggtgctcagc
gagcacctgtgccagggctggctcgagggctatctgctcaccggccgccacggcttcttc
tcttgctacgaggcgttcatccacctcatcgactcgatgttcaaccagcacgccaagtgg
atcaaatccgccaaggagctgccttggcgtgcccccatcgcctcgttgaactacctgctg
agctcccacgtctggcgccaggaccacaacggcttctcccaccaggatcccggcttcatc
gaccatgtggccaacaagaaggccgacacggtccgcatctatctgcccccggatgccaac
acgctgctgtccgtcaccgaccactgtctgcgctcgaaaaactatgtgaacctcatcatc
gccgggaagcaggccgcccccgtgtggctcgaccgcgagagcgccgtgcgccactgcgcg
gccggcattggcacctgggactgggcgagccacggcgagggcgaacccgacgtggtcatg
gcctgcgccggggatgtgcccaccctggaaaccctggccgcggtgaccgtgctgcgcgag
tgggcgcccgagctgaaggtgcgggtcatcaacgtcgtggacctcttcacgctggagacc
gtgggcgagcacccgcatgggttgaaccatgaagacttcaaccgcctcttcaccttggac
aagcccgtcatcttcgcgtttcacggctatcccaccatcgtgcacaagctcacgtacaag
cgggtgaaccacggcaacatccacgtccacggctacaaggaagaggggaccaccaccacg
cccttcgacatgaccgtgctgaacgacatggaccgctacaccctcgcgctcgacgccatc
cgccaggcgcccgccgcgcgccaccggctcgacgcggccgagcagcggtactcggaggtc
agccagcgccacaagctctacgtctccgagcacggcgaggacatgcctgaagtcaaaggc
tggaagtggaccgcccgatga

DBGET integrated database retrieval system