KEGG   Candidatus Solibacter usitatus: Acid_0546Help
Entry
Acid_0546         CDS       T00412                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acid_0546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_0546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acid_0546
Enzymes [BR:sus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acid_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
657907..659130
Genome map
AA seq 407 aa AA seqDB search
MPKATHLECSLCATKFDAGAAANLCACGGPLLVRYDLATIRHRWLRREVSNGPATMWRYA
PVLPPSDASVVTLGEGWTPLVRTKRLGARIGADSLWVKDEGLNPTASFKARGLSCAVSMC
VELGIKKVAIPSAGNAASAMAAYAAAAGIEAHIFMPRDVPQANYLECKAYGAHVTLIDGL
ISDCGRMVAEQGPKEGWFDVSTLKEPYRIEGKKTMGYEVAEQMGWELPEAIFYPTGGGVG
MIGMWKAFDEMERLGWIGGRRPKMIAVQAEGCQPVVRAFEAGEQRSKFFEGAHTVASGLR
VPKPLGDFLVLNAVRESGGTAIAVCDEDMLTAGVHLASDEGIYAAPEGAACVCAAQRLLK
SGFLKSTDRMVIYNTGSGLKYPEAYSTRFPRTAASEQDKLGGLITPR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagcgacccatctggagtgcagcctttgcgcgacgaagttcgacgccggggca
gccgccaacctctgcgcgtgcggaggccctttgctggtccggtacgatctggccactatc
cgacaccgctggctgcggcgcgaggtctccaatggcccggctacgatgtggcgttatgcg
ccggtgctgccgccatccgatgcttcggtggtgacactcggcgaaggctggacgccgctg
gtgcgcaccaagcgcctgggtgcgcggatcggagctgattcgctctgggtcaaagacgaa
gggctcaaccccacggcgtcgttcaaagctcgcgggctctcctgcgcggtatcgatgtgc
gtggaactcggaatcaagaaggtcgcaattccctccgcggggaacgcggcgagcgcgatg
gcggcgtacgcggcggccgccggcattgaggctcacattttcatgccgcgcgacgttccg
caagccaattacctggagtgcaaggcgtacggcgcgcacgtcacgctgattgacgggcta
atcagcgattgcggccgcatggttgccgaacaaggccccaaggaaggctggttcgacgtt
tcgacattgaaggagccataccgcatcgagggcaagaagacgatggggtacgaggtggcg
gagcagatgggttgggaactgccggaagcgattttctatccgaccggcggcggcgtgggc
atgatcggcatgtggaaggcgttcgacgaaatggaaaggctgggctggatcggcggacgg
cgtcccaaaatgatcgcggtgcaggcggaaggctgccagccggtggtgcgtgcattcgaa
gcgggcgagcagcgcagcaaattcttcgaaggcgctcatacggtggcgagcggactccgc
gtccccaaaccgctcggcgattttctggtgctgaacgcggtccgggagagcggtggtacg
gccatcgcggtgtgcgacgaagatatgttgaccgccggagtgcacctggccagcgacgag
ggcatctacgcggcaccggagggcgcagcctgtgtgtgcgccgcgcaacgcctgctgaaa
tccggattcctcaagagcactgatcgcatggtgatctacaatacgggatcgggtttgaag
taccccgaagcgtattcgacgcgattcccgcggacggcggcgagcgagcaggacaaacta
ggcgggctgatcacgccgcggtag

DBGET integrated database retrieval system