KEGG   Candidatus Solibacter usitatus: Acid_0914Help
Entry
Acid_0914         CDS       T00412                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_0914
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid_0914
  Amino acid metabolism
   00310 Lysine degradation
    Acid_0914
Enzymes [BR:sus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acid_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1141841..1143169
Genome map
AA seq 442 aa AA seqDB search
MTDVVMPQMGESIVEGTLTKWLKKPGERIERDEPLFEISTDKVDTEIPSPAAGTLAEVLV
EEGKTVGINTVVARISEGGSADGGAAAAKPVAAPAPPPPAAAAPPAAQAPVAPPPPPVQA
APPPPPAEAESPSGPLSPLVKKMAREMNLDLAQVKGTGAGGRITKQDVEAYVAAGKPAAA
PPSPAPAATPVQAAAPAPTPAPAMAPLAPAGQAKTRIEPMSTMRIKIAEHMVMSKRTSPH
VTTIHRVDMTKVAKMRERFKAQFQANYGFGLTYLPFITRATVAGLRQYPLLNASLDGNNI
IYHNEIHIGIAVALENGLIVPVVRSADEKNVLGLQRSIVDLAARARSRQLKPDEIQGGTF
SITNFGSFGSLVGTPVINQPQVAILGVGTVDKTPVVIDDAIAIRSICHLSLSFDHRLIDG
ALADQFMTKVKQVLENWSEEVL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtagtgatgccccagatgggcgaaagcattgtagagggtaccctgaccaag
tggctgaaaaagcccggcgagcgcattgaacgcgatgagccgctctttgaaatctcgacc
gacaaggtggataccgaaatcccgtctccggccgccggcaccctcgccgaagttctggtc
gaggaagggaagacggtcggcatcaataccgtggtcgcccgcatcagcgaagggggcagc
gccgatggcggcgccgccgcggccaagcccgttgccgcacccgctccgccgccgcccgct
gcagccgcgcctccggccgcgcaggctcccgtggcgccgcccccgccgcccgtccaggcc
gctcctccgccgcctcccgccgaggccgaatctccctccgggccgctttcgccgctggtg
aagaagatggctcgcgagatgaacctcgatctcgcgcaggtgaagggcacgggagctggc
ggacgcatcaccaagcaagatgtagaagcctatgtcgcggcgggcaaaccggctgccgct
ccgccgtcccccgctccggctgcgacgcccgtacaggctgctgcccccgcgccaacgcct
gcacctgcgatggcgcccctggcgcccgccggccaggccaagacccgcatcgagccgatg
agcacgatgcgcatcaagatcgccgagcacatggtgatgtccaagcgcacgtcgccgcac
gtcaccaccattcaccgcgtcgatatgaccaaggtcgcgaagatgcgcgagcgcttcaag
gcgcagttccaggccaactacggtttcggcctcacgtacctgcccttcatcacgcgcgcc
accgtcgccggcctgcgccagtacccgctgctcaatgcctcgctcgacggcaacaacatc
atctatcacaacgaaattcacatcgggatcgcggtcgcgctggaaaacggcctgatcgtt
cccgtggttcgttcggccgatgagaagaacgtgctcggcctgcagcgctccatcgtggat
cttgccgcgcgcgcccgcagccgccagttgaagcccgacgaaattcagggcggcacgttc
tcgatcaccaatttcggcagcttcggttcgctcgtcggaaccccggtcatcaatcagccg
caggtcgcgattctcggcgtcggcacggtggacaagactcccgtcgtgatcgacgacgcc
atcgccatccgcagcatctgccacctgtcgctcagcttcgatcaccgcctgatcgatggc
gccctggccgatcagttcatgacgaaggtcaagcaggtcctcgaaaactggtccgaagaa
gttctgtag

DBGET integrated database retrieval system