KEGG   Candidatus Solibacter usitatus: Acid_0914Help
Entry
Acid_0914         CDS       T00412                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_0914
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid_0914
  Amino acid metabolism
   00310 Lysine degradation
    Acid_0914
Enzymes [BR:sus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Acid_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1141841..1143169
Genome map
AA seq 442 aa AA seqDB search
MTDVVMPQMGESIVEGTLTKWLKKPGERIERDEPLFEISTDKVDTEIPSPAAGTLAEVLV
EEGKTVGINTVVARISEGGSADGGAAAAKPVAAPAPPPPAAAAPPAAQAPVAPPPPPVQA
APPPPPAEAESPSGPLSPLVKKMAREMNLDLAQVKGTGAGGRITKQDVEAYVAAGKPAAA
PPSPAPAATPVQAAAPAPTPAPAMAPLAPAGQAKTRIEPMSTMRIKIAEHMVMSKRTSPH
VTTIHRVDMTKVAKMRERFKAQFQANYGFGLTYLPFITRATVAGLRQYPLLNASLDGNNI
IYHNEIHIGIAVALENGLIVPVVRSADEKNVLGLQRSIVDLAARARSRQLKPDEIQGGTF
SITNFGSFGSLVGTPVINQPQVAILGVGTVDKTPVVIDDAIAIRSICHLSLSFDHRLIDG
ALADQFMTKVKQVLENWSEEVL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtagtgatgccccagatgggcgaaagcattgtagagggtaccctgaccaag
tggctgaaaaagcccggcgagcgcattgaacgcgatgagccgctctttgaaatctcgacc
gacaaggtggataccgaaatcccgtctccggccgccggcaccctcgccgaagttctggtc
gaggaagggaagacggtcggcatcaataccgtggtcgcccgcatcagcgaagggggcagc
gccgatggcggcgccgccgcggccaagcccgttgccgcacccgctccgccgccgcccgct
gcagccgcgcctccggccgcgcaggctcccgtggcgccgcccccgccgcccgtccaggcc
gctcctccgccgcctcccgccgaggccgaatctccctccgggccgctttcgccgctggtg
aagaagatggctcgcgagatgaacctcgatctcgcgcaggtgaagggcacgggagctggc
ggacgcatcaccaagcaagatgtagaagcctatgtcgcggcgggcaaaccggctgccgct
ccgccgtcccccgctccggctgcgacgcccgtacaggctgctgcccccgcgccaacgcct
gcacctgcgatggcgcccctggcgcccgccggccaggccaagacccgcatcgagccgatg
agcacgatgcgcatcaagatcgccgagcacatggtgatgtccaagcgcacgtcgccgcac
gtcaccaccattcaccgcgtcgatatgaccaaggtcgcgaagatgcgcgagcgcttcaag
gcgcagttccaggccaactacggtttcggcctcacgtacctgcccttcatcacgcgcgcc
accgtcgccggcctgcgccagtacccgctgctcaatgcctcgctcgacggcaacaacatc
atctatcacaacgaaattcacatcgggatcgcggtcgcgctggaaaacggcctgatcgtt
cccgtggttcgttcggccgatgagaagaacgtgctcggcctgcagcgctccatcgtggat
cttgccgcgcgcgcccgcagccgccagttgaagcccgacgaaattcagggcggcacgttc
tcgatcaccaatttcggcagcttcggttcgctcgtcggaaccccggtcatcaatcagccg
caggtcgcgattctcggcgtcggcacggtggacaagactcccgtcgtgatcgacgacgcc
atcgccatccgcagcatctgccacctgtcgctcagcttcgatcaccgcctgatcgatggc
gccctggccgatcagttcatgacgaaggtcaagcaggtcctcgaaaactggtccgaagaa
gttctgtag

DBGET integrated database retrieval system