KEGG   Candidatus Solibacter usitatus: Acid_0933Help
Entry
Acid_0933         CDS       T00412                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid_0933
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acid_0933
   00600 Sphingolipid metabolism
    Acid_0933
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Acid_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1174858..1177032)
Genome map
AA seq 724 aa AA seqDB search
MHRIAALCLLGCISVPAQIQYIESRKVWLLSTSNSAYAMGVGADGALRHLYWGAPIWRAE
DLAGAPVRRDISSFDPRQMLEAEEFPGWGGPRYYEPALKIAREDGNRDLVLRYASHRIQQ
NDLDIVLKDINDPIEVTLHYRVYPEHGILRRSATIRNGTARTVTVESAQSATWNLPPGEG
YQLTYLTGRWAAETQVNHEPIHEGQKVIESRKGHTSHNFNPWFAIDAGDAGEEHGSVWFG
ALGWSGNWRMAIEQTPYRQVRVTGGLNSFDFSYPLKPGETLETPPFYGGFSSAGFGPASR
MMHRFTREQILPGGAESRLRPVLYNSWEATTFAVNEQGQRELAAKAAKLGVELFVMDDGW
FGARNNDRAGLGDWTVNPKKFPEGLKGLIDHVHSLKMDFGLWVEPEMVNADSDLYRAHPD
WVINFPGRPRSELRTQMILNLARNDVKEYVFGFLDKLATENDIRYYKWDMNRSFSEPGWP
EVAGTEQRKIWVQYVRNVYEIIDRLRAKHPKLEIESCSGGGGRVDLGILQRVDEVWPSDN
TDAFDRLRIQEGFSMAYPAKIMSAWVTDVPNMNTRSTPLGFRFLTAMQGALGIGSNLNKF
TEQDSALAASMVATYKRIRATVQTGDLYRIASPRSSDVTVNEYVGADGRQAVVFAMRHSQ
EYNTAAPTIRLRGLDERAVYKLESVNNKLVERQGQFSGAYLMNAGINVNLRGDFDATAIV
LERQ
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcatcgccgccctctgcctgctcggctgtatcagcgtgccggcccaaatccag
tacatcgaatcgcgtaaggtttggctgctctccaccagcaacagcgcgtacgccatgggg
gtgggggcggatggcgcgctgcgccatttgtattggggcgcgccgatctggcgggcggag
gatctggcgggggcgcctgtgaggcgcgacatctcgtcgttcgatccgcggcagatgctg
gaggcggaagagttcccggggtggggcgggccgcggtattacgagccggcgctaaagatc
gcgcgggaggacgggaatcgcgacctggtgctgcggtacgcgtcgcaccgaattcagcag
aacgacctggatatcgtgctgaaggacatcaacgacccgatcgaggtcacgctgcactac
cgggtgtatccggagcacgggattctgcggcgctcggcgacgatacgcaacgggacggcg
cgaacggtgacggtggagagcgcgcagtcggccacgtggaatctgccgcccggcgaaggg
tatcagcttacgtacctgacggggcggtgggcggcggagacgcaggtgaatcacgagccg
atccacgaagggcagaaggtgatcgagagccggaaggggcacaccagccacaatttcaat
ccgtggttcgcgatcgacgcgggagacgcgggggaggagcacgggtcagtctggttcggc
gcgctggggtggagcgggaactggcgaatggcgatcgagcagacgccgtaccgtcaggtg
cgggtgacgggcggactcaacagcttcgatttttcgtatccgctgaaaccgggcgagacg
ctggagacgccgccgttctacgggggattttcgagcgcgggattcgggccggcgtcgcgc
atgatgcaccggttcacgcgggagcagattctgccggggggcgcggagtcgcggctgcgt
cctgtgctctacaactcgtgggaggcgacgacgttcgcggtgaacgaacaggggcagcgg
gaattggcggcgaaggccgcgaagctcggagtggaactgttcgtgatggacgatggctgg
ttcggcgcgcgcaacaacgaccgggcgggattgggcgactggacggtgaatccgaagaag
tttccggaggggctgaaggggctgatcgaccacgtacacagcctgaagatggatttcgga
ctgtgggtggagccggagatggtgaacgcggacagcgacctttatagggcgcatccggat
tgggtgatcaacttcccggggcgtccgcgcagcgagttgcgcacgcaaatgattttgaac
ctggcgcgcaacgatgtgaaggagtatgtgttcggcttcctggacaagctggcaacggaa
aacgatatccgctattacaagtgggacatgaaccgcagcttcagcgagccgggctggccg
gaggtggctgggacggagcagcgcaagatctgggtgcagtatgtgcgcaacgtgtacgag
atcatcgaccggctgcgggcgaagcatccgaagctggaaattgagagctgctcgggcgga
gggggccgggtggacctggggattctgcagagagtggatgaggtctggccgagcgacaat
acggatgcgttcgaccggctgcggatccaggaaggcttctcgatggcgtatccggcgaag
atcatgtcggcgtgggtgacggacgtgccgaatatgaacacgcggagcacgccgctgggg
ttccggttcctgacggcgatgcagggggcgctcggaatcggctctaacctcaataagttc
acggaacaggattcggcgctggcggcgagcatggtggcgacttataagcgcatccgggcg
acggtgcagacgggcgacctataccggatcgcgagtccgcggagcagcgatgttacggtg
aacgagtatgtgggggcggacggaagacaggcggtggtgttcgcgatgcggcattcgcag
gagtacaacacggcggcgccgacgatccggctgcggggattggacgagcgggcggtgtat
aagctggaatcggtgaacaacaaactggtggagcgccaggggcagttcagcggcgcgtac
ctgatgaatgccgggatcaacgttaacttgcgcggagatttcgacgcgacggcgatcgtt
ttggagcggcagtaa

DBGET integrated database retrieval system