KEGG   Candidatus Solibacter usitatus: Acid_1043Help
Entry
Acid_1043         CDS       T00412                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acid_1043
   00052 Galactose metabolism
    Acid_1043
   00500 Starch and sucrose metabolism
    Acid_1043
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_1043
Enzymes [BR:sus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acid_1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288316..1289200
Genome map
AA seq 294 aa AA seqDB search
MPAKVRKAVFPAAGLGTRFLPATKAQPKEMLPIVDKPIIQYGVEEAIHSGIQNIIIVTGR
GKTAIEDHFDVSFELEYLLESRGKKELLAIVRSISDMISVSYIRQKEALGLGHAVLRSLE
LIGDEPFSVVLADDVIEAETPCLRQLLDVYEFFAAPVLAVMEVPPENISAYGAIDAEPVM
HNGRNDRVYRIRDLVEKPKQSDAPSNLAIIGRYVLTPEIFGSLQSIDPGSGGEIQLTDAL
RHLLRSRPIYAYRFDGTRYDAGDKLGFLKATVEYALRRHDLGGPFREYLKTLKL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaaaagtccgaaaagccgtcttccctgccgccggtctgggaacccgcttcctg
cctgccaccaaagcgcagcccaaagagatgttgccgattgtggataaacccatcatccag
tacggggtggaggaggcgatccattcgggcattcaaaacatcatcattgttacaggtcgc
ggcaagaccgccatcgaagaccacttcgacgtcagcttcgagctggagtacctgctggag
tcgcgcggcaagaaggagctgctcgccatcgtgcgcagcatttccgacatgatcagcgtc
tcctacattcgtcagaaggaggcgctcggactcggtcacgccgtgctgcgttcgctcgaa
ctgatcggcgacgagcccttcagcgtggtcctggccgacgacgtgatcgaggccgagact
ccctgcctgcgccagcttctcgatgtctacgaattcttcgcggcgccggtcctcgccgtc
atggaggtgccgccggagaacatttccgcttatggtgccatcgatgccgaaccagtgatg
cataacggccgcaacgatcgcgtctaccgcatccgcgacctggtcgaaaagccgaagcag
agcgatgcgccttcgaacctcgccatcatcggtcgctacgtcctgacgcccgagatcttc
ggctccctgcaatccatcgatcccggcagcggcggcgaaatccaactcaccgacgcgctt
cgccacctgctccgcagccggcccatctacgcttaccgcttcgatggcacccgctacgat
gcgggcgacaaactcggcttcctcaaagccaccgtcgaatacgccctccgccgccatgac
ctcggcggccccttccgcgagtacctcaagacgctgaagctctga

DBGET integrated database retrieval system