KEGG   Candidatus Solibacter usitatus: Acid_1097Help
Entry
Acid_1097         CDS       T00412                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
sus  Candidatus Solibacter usitatus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Acid_1097
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acid_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1348620..1348976
Genome map
AA seq 118 aa AA seqDB search
MKYLVAFIVAVCALWKASAAGPPGKDLFERRCTGCHAIDREKSGPRLAGVYGRRAGAIAG
FTYSESLRKSGVVWDRATLDRWLANPESVVPDNDMPFRLADEGERQAIIEYLRQISSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacctcgtggccttcatcgtcgccgtgtgcgccctctggaaggcgagcgcggcc
gggccgccgggcaaggatctcttcgaacggcgctgcaccggctgccacgccatcgatcgc
gagaagagcggcccccgcctcgccggtgtctacggccgccgcgccggcgccatcgcgggc
tttacctactccgagtcactgcgcaaaagcggcgtggtctgggaccgcgccacgctcgat
cgctggcttgccaatcccgaatccgtggtgcccgacaacgacatgccgtttcgcctggcc
gacgagggggagcggcaggcgatcatcgaatacctgcggcagatctcgtcaaagtaa

DBGET integrated database retrieval system