KEGG   Candidatus Solibacter usitatus: Acid_1097Help
Entry
Acid_1097         CDS       T00412                                 

Definition
class I cytochrome c
Orthology
K08738  
cytochrome c
Organism
sus  Candidatus Solibacter usitatus
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sus00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sus02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1348620..1348976
Genome map
AA seq 118 aa AA seqDB search
MKYLVAFIVAVCALWKASAAGPPGKDLFERRCTGCHAIDREKSGPRLAGVYGRRAGAIAG
FTYSESLRKSGVVWDRATLDRWLANPESVVPDNDMPFRLADEGERQAIIEYLRQISSK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacctcgtggccttcatcgtcgccgtgtgcgccctctggaaggcgagcgcggcc
gggccgccgggcaaggatctcttcgaacggcgctgcaccggctgccacgccatcgatcgc
gagaagagcggcccccgcctcgccggtgtctacggccgccgcgccggcgccatcgcgggc
tttacctactccgagtcactgcgcaaaagcggcgtggtctgggaccgcgccacgctcgat
cgctggcttgccaatcccgaatccgtggtgcccgacaacgacatgccgtttcgcctggcc
gacgagggggagcggcaggcgatcatcgaatacctgcggcagatctcgtcaaagtaa

DBGET integrated database retrieval system