KEGG   Candidatus Solibacter usitatus: Acid_1261Help
Entry
Acid_1261         CDS       T00412                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
sus  Candidatus Solibacter usitatus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1560517..1561488
Genome map
AA seq 323 aa AA seqDB search
MKPALVTGASGFLGWHVARVLVERGLHVRALVRPGSKVVGIDVECVTGDLRDPASLALAV
KGCGLVFHVAADYRLWAKDPTELYRSNVDGTRNLLEAARQAGVERTVYTSTVGCIGMPRD
GIGDEAQPVKLAHMAGDYKRSKFLAEKVALEFARAGQPVVIVNPTAPLGDHDVKPTPTGK
IVLDFLKGDMPAFIDTGLNVVDVRDTAEGHWQACERGRSGERYILGSENLTLAQILQKLA
AITGRKAPTLQLPYALAYCAGACSTAWAAVTGRPPRVPLEAVRMAKKKMWVSHDKAAREL
GFQPGPAEKALRHAVDWFRQTAA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggctctggtaacgggcgcttccggatttctcggctggcatgtggcgcgcgtg
ctggtggagcgcggactccacgtccgggcgctggtccgaccgggcagtaaggtcgtcggc
atcgacgtggagtgtgtcacgggcgatttgcgcgatcccgcctcgctggcccttgcagtc
aaaggttgcggccttgtgtttcacgtggcggcggattaccgtctgtgggccaaggacccc
acggagttgtaccggtcgaatgtggacggcacgcgcaatctgctggaggcggcgcgccag
gcgggcgtggagcgaacggtctataccagcacggtgggctgtatcggcatgccgcgggac
ggcattggcgacgaagcgcagccggtgaaactagcccacatggcgggggactacaagcgc
tccaaattcctcgcggagaaggtcgcgctggaattcgcgcgcgccgggcagccggtggtg
atcgtaaaccccacggctccgcttggcgatcatgacgtgaagccgacgcccacgggcaag
atcgtcctcgattttctgaagggcgacatgccggcattcatcgataccgggctaaacgta
gtggacgtgcgcgatacagcggagggacactggcaggcgtgcgagcgtggacgctccggc
gagcgctacatcctgggctcggagaatcttacgctggcgcagattctgcaaaagctggcg
gcaatcacgggcaggaaagcgcccaccctgcaactgccgtacgcactggcctattgcgcg
ggcgcgtgcagcacagcctgggccgccgtcaccggccgtccgccccgggtgccgctcgaa
gccgtgcggatggcgaagaagaagatgtgggtgagccacgataaggccgcgcgtgaactg
ggctttcagccgggtccggccgagaaggcgctgcggcacgcagtggactggttccgccaa
accgctgcctga

DBGET integrated database retrieval system