KEGG   Candidatus Solibacter usitatus: Acid_1458Help
Entry
Acid_1458         CDS       T00412                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sus00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sus00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1788348..1789499
Genome map
AA seq 383 aa AA seqDB search
MSYTRWSMCALLGVITLACFTQACSRKETSAVNAETKPPQPYGKMPDGTPVELYTLTNAN
GMQAGIITYGGILTSLTAPDKTGKFADVVLGMDDLPGYLKEKDYFGALIGRYGNRIGHAQ
FTLDGQTYKLPDNNNGATLHGGIKGFDKHVWTAKPVSSPDGQAVELTYVSKDGEEGFPGT
LTAKVVYTLTPRNELNIDYTATTDKPTVVNLTNHSYFNLAGPGSGDILSHEVMIAADKFT
PVDAILIPTGELKDVKGTPFDFTTMTAIGARINQPDEQLKFGRGYDHNWVLNKGAGGMTK
AAEVHEPVTGRTMEVWTTEPGLQFYTGNFLDGTNKAKGKSFDLRGAFCMETQHYPDSPNK
PAFPSTELKPGATYHTTTSYRFR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagttacactcgctggtccatgtgcgccctgctgggcgtgatcactctggcctgcttt
acccaggcctgctccaggaaggaaacctccgccgtgaatgcagaaaccaagccgccgcag
ccctacggcaagatgcccgatggcacccccgtcgagctctacacgctcaccaacgccaac
ggcatgcaggccggcatcatcacctatggcggcatcctgacctcgctcactgcccccgat
aagaccggcaagttcgccgacgtcgttctcggcatggacgacctgcccggctacctcaaa
gagaaggattacttcggagccctgatcggccgctatggcaatcgcatcggccacgcccag
ttcactctcgacggccagacctacaagctccccgacaacaataacggcgccactctccac
ggcggcatcaagggcttcgacaagcacgtctggaccgccaaacccgtttccagtcccgat
ggccaggccgtcgaacttacctacgtcagcaaggatggtgaagaaggcttccccggaacc
ctcaccgccaaagtcgtctacaccctcactcccaggaacgagctcaacatcgattacacc
gccaccaccgacaagcccaccgtcgtcaacctgaccaaccactcatacttcaatctcgcc
ggccccggctccggcgacatcctctcccacgaagtcatgatcgccgccgacaagttcacc
cccgtcgatgcgatcctcatccccaccggcgagctcaaggacgtcaagggcacccccttc
gacttcaccaccatgaccgccattggcgcgcgcatcaatcagcccgatgagcagctcaaa
ttcggccgcggctacgatcacaattgggtcctcaacaaaggcgccggcggtatgaccaag
gccgccgaagtccacgagcccgtcaccggccgcaccatggaagtctggaccaccgagccc
ggcctgcagttctataccggcaacttcctcgatggcaccaacaaggctaaaggcaagagt
ttcgacctgcgcggcgccttctgcatggagacccagcactatcccgattcgcccaacaaa
ccggccttcccctccaccgagttgaagcccggcgccacctaccacaccaccaccagctac
cgcttccggtaa

DBGET integrated database retrieval system