KEGG   Candidatus Solibacter usitatus: Acid_1458Help
Entry
Acid_1458         CDS       T00412                                 

Definition
(RefSeq) aldose 1-epimerase (EC:5.1.3.3)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_1458
   00052 Galactose metabolism
    Acid_1458
Enzymes [BR:sus01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Acid_1458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1788348..1789499
Genome map
AA seq 383 aa AA seqDB search
MSYTRWSMCALLGVITLACFTQACSRKETSAVNAETKPPQPYGKMPDGTPVELYTLTNAN
GMQAGIITYGGILTSLTAPDKTGKFADVVLGMDDLPGYLKEKDYFGALIGRYGNRIGHAQ
FTLDGQTYKLPDNNNGATLHGGIKGFDKHVWTAKPVSSPDGQAVELTYVSKDGEEGFPGT
LTAKVVYTLTPRNELNIDYTATTDKPTVVNLTNHSYFNLAGPGSGDILSHEVMIAADKFT
PVDAILIPTGELKDVKGTPFDFTTMTAIGARINQPDEQLKFGRGYDHNWVLNKGAGGMTK
AAEVHEPVTGRTMEVWTTEPGLQFYTGNFLDGTNKAKGKSFDLRGAFCMETQHYPDSPNK
PAFPSTELKPGATYHTTTSYRFR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagttacactcgctggtccatgtgcgccctgctgggcgtgatcactctggcctgcttt
acccaggcctgctccaggaaggaaacctccgccgtgaatgcagaaaccaagccgccgcag
ccctacggcaagatgcccgatggcacccccgtcgagctctacacgctcaccaacgccaac
ggcatgcaggccggcatcatcacctatggcggcatcctgacctcgctcactgcccccgat
aagaccggcaagttcgccgacgtcgttctcggcatggacgacctgcccggctacctcaaa
gagaaggattacttcggagccctgatcggccgctatggcaatcgcatcggccacgcccag
ttcactctcgacggccagacctacaagctccccgacaacaataacggcgccactctccac
ggcggcatcaagggcttcgacaagcacgtctggaccgccaaacccgtttccagtcccgat
ggccaggccgtcgaacttacctacgtcagcaaggatggtgaagaaggcttccccggaacc
ctcaccgccaaagtcgtctacaccctcactcccaggaacgagctcaacatcgattacacc
gccaccaccgacaagcccaccgtcgtcaacctgaccaaccactcatacttcaatctcgcc
ggccccggctccggcgacatcctctcccacgaagtcatgatcgccgccgacaagttcacc
cccgtcgatgcgatcctcatccccaccggcgagctcaaggacgtcaagggcacccccttc
gacttcaccaccatgaccgccattggcgcgcgcatcaatcagcccgatgagcagctcaaa
ttcggccgcggctacgatcacaattgggtcctcaacaaaggcgccggcggtatgaccaag
gccgccgaagtccacgagcccgtcaccggccgcaccatggaagtctggaccaccgagccc
ggcctgcagttctataccggcaacttcctcgatggcaccaacaaggctaaaggcaagagt
ttcgacctgcgcggcgccttctgcatggagacccagcactatcccgattcgcccaacaaa
ccggccttcccctccaccgagttgaagcccggcgccacctaccacaccaccaccagctac
cgcttccggtaa

DBGET integrated database retrieval system