KEGG   Candidatus Solibacter usitatus: Acid_1559Help
Entry
Acid_1559         CDS       T00412                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acid_1559
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_1559
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acid_1559
Enzymes [BR:sus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acid_1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1916940..1918247
Genome map
AA seq 435 aa AA seqDB search
MPAELACFEERCRARFPITEVLYNCPHCGGLLEAVYGKPAQSADELKCLWRTRRTSNHPL
DQSGVWRYREFIPFLDDYAHAVTLREGCTPLLPGRLAAEYGGLDALVFKHQGFNPTGSFK
DNGMTCGASQAMRLGMTRVACVSTGNTSASMAAYASAAGLQPVIFIPHGNISFGKLAQAL
EYGAKTIQVEANFDQILALVRQVAERLGIYLLNSINPFRIEGQKTIMAEMLDQRDWNVPD
WVVLPGGNLGNTSAFGKGLRELKELGLIDRLPRLAVIQAEGSAPFYDLMQGRDRTHLTPV
SHPETLATAIKIGDPVSWPKALHEVTTSGGVVEKVSEQEIADAKAVIGRCGIGCEPASAA
TLAGIRKLTASGIMRSDSDIVAVLTGNVLKDPSYIHQYHTGVLKTDGGSPIRPSFGNPPV
VLPNDSAKIADFLSV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcggaactagcctgttttgaagagcggtgccgcgcgcggtttccgatcaccgaa
gtcctctacaattgcccgcactgcggcggtctgttggaagcggtgtacggcaaaccggcg
caatccgccgatgagctcaaatgcctgtggcgcacccgccgcacgtccaaccacccgttg
gatcagagtggagtgtggcgctatcgcgagttcatcccgttcctggacgactacgcacac
gcggtcacgctccgcgaaggctgcaccccgctgctgccgggccgcttggccgcggagtac
ggcggcctggacgcgctcgtcttcaagcaccagggcttcaaccccaccgggtccttcaag
gacaacggcatgacctgcggcgcgtcgcaggccatgcggctcgggatgacgcgggtggcc
tgcgtctccaccgggaatacgtcggcctccatggcggcctacgcgagcgcggccggcctg
cagcccgtgatcttcattccacatggcaacatctccttcggcaaactcgcgcaggcgctg
gagtacggcgccaaaaccatccaggtggaagcgaatttcgatcagattctggcgctggtg
cggcaggtagccgagcgcctgggaatctatctgctgaactcgatcaaccccttccgcatc
gaaggccaaaaaacgatcatggccgagatgctggatcagcgcgattggaacgtgccggac
tgggtggtgctgccgggcggcaacctcggcaatacctcggccttcggaaaaggcctccgc
gaactcaaggaactcggcctgatcgaccggctgccgcgcctggccgtgatccaggccgag
ggctctgcgccgttctacgacctgatgcaggggcgggatcgaacccacctgacaccagtc
agccatccggagacgctggccaccgcgatcaaaatcggcgatccggtttcctggcccaag
gccctgcacgaagtgaccacgtcgggcggcgtggtggagaaggtgagcgagcaggagatt
gcggacgccaaagcagtgatcgggcgttgcggaatcggttgtgagccggcttccgcggcc
accctggctggaattcgcaagctaactgcttctggaataatgcgttccgactcggatatc
gtggcagttcttaccggaaatgtcttaaaagaccctagctatatccaccagtaccacaca
ggggtattaaagacggacgggggcagcccgatccggccttccttcggaaatccaccggta
gtattacccaatgactcagcgaaaatagctgattttctaagtgtttaa

DBGET integrated database retrieval system