KEGG   Candidatus Solibacter usitatus: Acid_1588Help
Entry
Acid_1588         CDS       T00412                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sus00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sus00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sus00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1948227..1949783)
Genome map
AA seq 518 aa AA seqDB search
MRFAALALCAASVYAADLTGRWTGPASTADNGQELVLALKQAPGGGFSGYVQGPRATDTI
VGGKLEGANLTLDVERPGRNNAVQKLAYIGVVEGNKLKLTLPSPFGGRGGAQQKAPPKAP
PVPQVVELSRVSNDAPAPLPARPAPVSLPMPEPVHANGLAKTPPMGWNSWNKFRNQVSDK
MVREIADAMVKSGMKAAGYVYVNIDDTWEGAHRDAQGNITTNNKFPDMKALSAYVHSKGL
KLGIYSSPGPKTCAGYEGSYQHEEQDAKTYAAWGIDYLKYDWCSASQVYDNTQATMVNAY
AKMGLGLLNSGRKIVYSLCQYGNLDVGAWGERVGGNLWRTTGDISDRWDSMQRLGFELQT
DREKVAGPGHWNDPDMLEIGNGGMTNDEYKTHMSLWCILASPLLAGNDIRDMKPEVADIL
MNKEVIAVDQDKLGKQGKRVAKDGDKEVWAKPLADGSHAVALFNRGADTASVTAKWSDLG
INGARTIRDLWKHADLGRKSGEFTATVPSHGVVMVRIK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagattcgctgcactggcgctgtgcgccgcatctgtctatgctgccgatttgaccgga
cgttggaccggccccgcctcgaccgcggataacggtcaggaactggtgcttgccctcaag
caggcgccgggcggcggtttctcgggctacgttcaagggccgcgcgccaccgacaccatt
gtcggcggcaaactggaaggcgccaacctgacgctcgacgtggaacggccaggccgcaac
aacgcagtgcaaaagctcgcctacatcggagtagtggagggtaacaagctcaagttgacg
ctgccctcaccgttcggtggacgcggcggagcgcagcagaaggccccgcccaaggcgccg
cctgttcctcaggtcgtggagttgtcgcgcgtctcgaacgatgccccagctcccctgccg
gcgcgccccgcgcccgtatcgctgcccatgcccgagccggtccacgccaacggcctggcc
aagaccccgccgatgggctggaacagttggaacaagttccgcaaccaggtaagcgacaaa
atggtccgcgaaatcgccgacgccatggtcaagagcggcatgaaggccgccgggtacgtg
tacgtcaacatcgacgatacctgggaaggcgcgcaccgcgacgcacagggcaacatcacc
actaacaacaaattcccggacatgaaagccctctccgcctatgtccattccaagggactc
aagctgggcatttactcgtcgccgggaccgaagacctgcgcgggctatgaaggcagttat
cagcacgaggaacaggacgccaagacctacgcagcctggggcatcgactacctcaagtac
gattggtgcagcgcgtcccaggtctacgacaacacccaggccaccatggtcaatgcgtac
gccaagatgggacttggcctgctgaactccggccgcaaaatcgtctacagcctctgtcag
tacggcaatctggacgtcggcgcgtggggagaaagggtgggcggcaatctgtggcgcacc
accggcgatatttcggatcgctgggactccatgcagcggcttggcttcgagttgcaaacc
gatcgagagaaggtcgccggccccggccactggaacgatcccgacatgctggagatcggc
aacggcggcatgacgaatgacgagtacaaaacccacatgagcctgtggtgcattctggcc
tcgccgctgctcgccggcaacgatatccgtgacatgaaacccgaagtagccgacatcctc
atgaataaggaagtcatcgccgtggaccaggacaaactcgggaaacaaggcaagcgcgtg
gccaaggatggcgataaggaagtctgggcgaagccgctcgccgacggcagtcacgcggtg
gccttgttcaaccgcggcgccgacaccgccagcgtcacggccaaatggagcgacctcggc
atcaacggcgcccgaaccatccgcgacttatggaaacacgcggacctcggcaggaaatcc
ggcgagttcaccgccaccgtccccagccacggcgtcgtcatggttcggatcaaataa

DBGET integrated database retrieval system