KEGG   Candidatus Solibacter usitatus: Acid_1834Help
Entry
Acid_1834         CDS       T00412                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Acid_1834
Enzymes [BR:sus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Acid_1834
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Acid_1834
Lipid biosynthesis proteins [BR:sus01004]
 Fatty acid synthase
  Component type
   Acid_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2287344..2288033
Genome map
AA seq 229 aa AA seqDB search
MRKFWLVPIVVLWAGCGKQEEPAAKQVAKQAPAAAVAPAQNPSADDRPAIVVFGDSISAG
FGLDAGQSFPDLLQKDLDARGVRYRVVNMGVSGDTTQDGLARLSMALAEKPKIVLLELGA
NDGLRGIPSSVMQANLAQMIEAYQAAGAQVVLAGMTLPPNYGPEFIKRFDAVYAGLAEKY
HVTLIPFLMAGVGGHEDMMQRDGLHPNAAGARKVEQLVMKTLAPLLGTR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaattctggttagtgccgattgtggtgttgtgggcgggctgcggaaagcaggaa
gagcccgcggcgaagcaggtagcgaagcaggcccccgcggcggcagtcgcgccggcgcag
aatccgtcggccgatgaccggccggcaatcgtggttttcggcgacagcatcagcgcgggc
ttcgggctggatgcgggacagagctttcccgacctgctgcagaaagatctggacgcacgt
ggggtgcggtatcgcgtggtcaacatgggtgtgagcggcgataccacccaggacgggttg
gcgcgcctatcgatggcgctggccgagaagccgaagatcgtgctgctcgaactgggcgcg
aacgacgggctgcgcggcattccatcctccgtcatgcaggcgaacctggcgcagatgatc
gaggcctatcaagccgcgggtgcgcaggtggtgttggccgggatgacgctgccacccaac
tatggaccggagttcatcaagcgattcgacgcggtgtatgccgggctggcggagaagtac
cacgtgaccctgattccgttcctcatggcgggcgttggcggccacgaggatatgatgcag
cgcgatggtctgcaccccaacgcggcaggcgcgcgtaaagtggagcagctggtgatgaag
acgctggcgcccctgctcgggacgcgctaa

DBGET integrated database retrieval system