KEGG   Candidatus Solibacter usitatus: Acid_2070Help
Entry
Acid_2070         CDS       T00412                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid_2070
Enzymes [BR:sus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Acid_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2631345..2632859
Genome map
AA seq 504 aa AA seqDB search
MNNQVQLITYVDRLGGGGLQTLRSLLEGPLREMFGGVHLLPFFHPIDGVDAGFDPIDHTQ
VDPRLGTWDDLRALGSTLEITADLIVNHVSTQSPQFEDYSRRGAASAFSGMFLTFDRVFP
QGATESDLLRIYRPRPGLPFTTVLLRNGEQRLIWTTFTPQQVDIDVRSPMGAAYIGSILE
RFQSAGVTMIRLDAVGYAIKKAGTSCFMIPETFDYIAELTQQAHALGIEVLVEIHSYYRD
QIEIARKVDRVYDFALPPLVLHTLFEKNARALKEWLAVSPRNAVTVLDTHDGIGVIDVGA
DARDPQGRAGLLPPEGIDRLVETIHARSRGESRKATGAAANNLDLYQVNCTFYDALGRRD
DEYLIARAIQFFAPGIPQVYYTGLFAGINDMDLLARTGVGRDINRHYYAAEEVREHLERP
VVRRHLELIRFRNRHGAFNGSFEVASSPDKRLVLEWRDGAEWARLEVDLASLTAMISYST
PQGTQTLDVTSLGAASKSAQGEVR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccaggttcaactgatcacttatgtggaccgccttggcggcggcggacttcag
acgctgcggtccttgctcgaagggcctctgcgggagatgttcggcggcgttcatttgctg
ccgttctttcatccgattgacggagttgacgcgggcttcgatccgattgaccacacccag
gtggacccgcgcctcggcacgtgggatgaccttcgcgctctaggcagcacgctcgaaatt
acggcggacctgattgtgaaccacgtctctacccaatcgccgcagttcgaggactattcg
cggcgtggcgcggcatcggcgttctccggcatgttcctcaccttcgatcgcgtgtttccc
caaggcgcgaccgaatcggatctcctccgcatctaccgcccgcggccagggctgccattt
acgacggtcctgctccgcaatggcgagcagcggctaatctggacgacgtttaccccgcaa
caggtggatatcgacgttcgcagcccaatgggtgcggcatacatcggcagcattctcgag
cggttccagtccgccggcgttaccatgatccgcctggacgcagtcggctacgcgatcaag
aaagccggcacgagctgcttcatgatcccggagacgttcgattacatcgccgagttgaca
cagcaggcgcacgcgctagggatcgaggtgctggtcgaaatccacagctactatcgcgac
cagatagagatcgcccgaaaggtggaccgtgtctacgacttcgcgctgccgccgctagtg
cttcacacgctgttcgagaagaacgcgcgcgcacttaaagagtggctggccgtgagtccg
cgcaatgcggtaacagtgctcgatactcacgacggcatcggcgtgatcgatgtcggagcg
gacgcccgcgacccacagggccgcgcgggcctgctgccgccggaaggcatcgaccggctc
gtcgaaaccattcatgcgcgcagtcgaggggaaagccgcaaggccacgggcgccgctgcc
aacaacctggacctatatcaggtgaactgcacgttctacgatgctcttggacgccgcgac
gacgaatacctgatcgcgcgagccatccagttcttcgctcccggaattccgcaggtttat
tacaccggcctcttcgcaggaatcaatgatatggacctgttggcgcgcaccggtgtcggg
cgggatatcaaccggcactactatgctgccgaagaggtgcgagagcatctggaacgtccg
gtcgtgcggcgtcacctggaactgatccggttccgcaaccggcacggcgccttcaacggg
agctttgaagtggcgtcctcaccggataagcgtctggtcctcgaatggcgcgacggcgcg
gaatgggcgcggctggaggtcgatctcgcgagtctcacggcgatgatttcgtattcgacg
ccgcaaggtacacagaccctcgatgtgacatccctgggggccgcatcgaagtccgcacaa
ggagaagtcagatga

DBGET integrated database retrieval system