KEGG   Candidatus Solibacter usitatus: Acid_2208Help
Entry
Acid_2208         CDS       T00412                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid_2208
Enzymes [BR:sus01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Acid_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2829145..2830641
Genome map
AA seq 498 aa AA seqDB search
MSQATPELPHTLGALRTSSFSEEKLAQRSVKDEIRKNLICAIQRGETLFPGIIGYEDSVV
PQVVNALLSRHNFILLGLRGQAKTRLIRQLTNLLDEWTPYLAGCEIHDNPYAPICRRCRD
LVADQPDDAHIAWLHREQRYVEKLATPDVTIADMIGDIDPIKAARRGQDISDELTVHYGL
LPRANRGVFAINELPDLAGKIQVGLFNIMQEGDVQIKGYPVRMPLDVLLVFTANPEDYTA
RGKIITPLKDRIGSEIRTHYPAVLEQGIAITEQEAWLERPSPVEVRVPDYMRRVVEQLAF
LAREDKRVDKRSGVSQRLPISVLENVVSNAERRALKAKDDMAVPRVTDLYSAMPAITGKL
ELEYEGELKGGDTVARELIRASVGKIFNESFEGVNFANIIQWFDLGGSLKLDEGVSSAQM
VQQLGGIQGLMEKTKGLNLSSNEPDAVRAAAAEFILEGLYAHRRIGRSEERGFSAEEKPA
RREQESRPERPNMRRPLN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcaagccactccggaattgccccacactctaggcgcgcttcgcaccagttccttc
tccgaagagaaactagcgcaacgcagcgtaaaagacgaaatccgaaaaaacctgatctgt
gcgattcagcggggggaaacgctattccccgggatcatcggatacgaggattcggtagtg
ccgcaggtggtgaacgcactgctctcgcggcacaacttcattctgctgggactgcgcggg
caggcgaagacgcgcctgatccggcagctcacgaacctgctggacgaatggacgccgtac
ctggccggctgcgagattcacgataatccgtacgcgccgatttgccggcgatgccgcgac
ctggtggcggaccagccggacgatgcgcacatcgcgtggctgcaccgcgagcagcgctac
gtggagaagctggcgacgccggacgtgacgatcgcggacatgatcggcgatatcgacccg
atcaaggcggcgcggcgcgggcaggatatctccgacgaactgacggtgcattacggcctc
ttgccgcgcgcgaatcgcggcgtattcgcgatcaacgaactccccgacctggcgggcaag
atccaggtggggctgttcaacatcatgcaggaaggcgacgtccagattaagggatatccg
gtgcggatgccgctggacgtgctgctggtgttcacggcgaatccggaggactacacggcg
cgagggaagatcatcacgccgctgaaagaccgcattgggagcgagatccgcacgcattat
ccggcggtgctggagcaaggcatcgcgatcacggagcaggaggcatggctcgagcgcccc
tcgccggtggaggtgcgggtgccggattacatgcggcgcgtggtggagcaactggcgttt
ctggcgcgcgaggacaagcgcgtggacaagcgctccggcgtgagccagcggctgccgatt
tcggtgctggaaaacgtggtctcgaacgcggagcggcgcgcgctgaaggcgaaggacgat
atggcggtgccgcgggtgaccgatctttactcggcgatgccggcgatcacgggcaagctg
gagttggagtacgaaggcgagttgaagggaggcgacaccgtggcgcgcgagctgatccgc
gcgtcggtgggcaaaatcttcaacgagagcttcgaaggcgtgaacttcgcgaacatcatc
caatggttcgacctgggcggatcgctgaagctggacgagggtgtgagcagcgcgcagatg
gtgcagcaactgggcggaatccaggggctgatggagaagaccaagggactcaacctgagc
tccaacgagccggacgcggtgcgggcggcagcggcggagttcattctcgaggggctgtac
gcgcatcgccggatcgggcgcagcgaagagcgcggattctccgcggaggagaaaccggcg
cggcgcgaacaagagagcaggccggagcggcccaacatgcggcgtccgttgaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system