KEGG   Candidatus Solibacter usitatus: Acid_2220Help
Entry
Acid_2220         CDS       T00412                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sus  Candidatus Solibacter usitatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sus00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sus00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2842458..2844269
Genome map
AA seq 603 aa AA seqDB search
MLVLAAATSAGPARSESARKAAATKSVAAKSAPLKASPTVRRWMKTMTLRDEIAQLIFIA
FHGAAPNSRSREYRNFMHQIRDNKVGGLILVNWSNGRVIQKAEPYAVAAFLNRMQRLAKT
PLMVSGDFERGASMRVDGTTVFPHAMAFGATGDPAYSRYEGEVTAREARALGVQWLYYPV
ADVNNNPDNPIINIRSFGENPEAVAAQVVAFVQGAHADKKNYALATVKHFPGHGDTAVDS
HMNMPTITADRERLNHIELVPFKAAIDAGVDSVMTAHIAVPALSPPDLPSTLSPAILTDL
LKKELGFKGIVVTDALEMAGIAKGFSTGDAAVRALEAGADVLLMPTDPDAVIKAVAAAVQ
SGRLTRQRIQESLLKVLSAKEKVGLDKKRFADLEAIGDVVDSPEANEKAQEIAEHAVTLV
RNNSNMIPLAAPDRACYVIMPESRFGSEGQAYTQELRKTVARATVVSWDATLSRQQLDDG
VSKLSGCESYVVAAFTSVGAYRGTVGMLGGELPHALEGLMATGKPVALIALGNPYVLRNF
GNVTSYLATFSNVPPCEIAAVRAVLGQIPIRGHLPVTIPGQAKYGDGIQLPAAHPIRVSG
ASQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcctagccgcggctacgagtgcgggaccagcgcgttccgagtccgcccgtaag
gcggcagcgacaaaatcggtcgccgcgaaatcggcgccgctgaaggcatcccccaccgtg
cggcggtggatgaagacgatgacgctgcgcgatgagatcgcgcaattgattttcatcgca
ttccatggggcggcgcccaattcccgttcgcgcgaatatcgaaatttcatgcaccagatc
cgcgataacaaggttggcggactgatcctggtgaactggtcgaacggacgcgtcattcag
aaggcggagccctacgcggtggcggcattcctcaatcgcatgcagcggctcgcgaagacg
ccattgatggtcagcggcgatttcgagcgcggcgcctccatgcgggtggatggcaccact
gtgttcccgcatgcgatggccttcggcgcaaccggggaccccgcgtactcgcggtatgaa
ggcgaagtgacggcgcgcgaggcgcgcgctcttggggttcaatggctctactatccggta
gccgatgtgaacaataaccccgacaatccgatcatcaacatccggtccttcggcgaaaat
cccgaggccgtggcggcgcaggtggtcgcatttgtccagggagcgcacgcggataagaag
aactacgcgctggccaccgtgaaacatttcccgggccacggcgacacggccgtggacagc
cacatgaacatgcccacgatcacggccgaccgcgagcggttgaaccacatcgagctggtg
cccttcaaggcggcgatcgatgccggcgtggattcggtgatgacggcgcacatcgcggtg
cctgcgctttcgccgcctgacctgccctccacgctgtcacccgcgattcttaccgacctg
ctgaagaaggagctcggcttcaaaggcatcgtggtcacggacgccctggagatggccggc
atcgccaaaggctttagcaccggcgacgcggcagtgcgcgcgctggaggcgggagccgac
gtgctgttgatgccgaccgaccccgatgcggtgatcaaagccgtggccgccgccgtacag
agcggacgcctgacgcgccagcggattcaggaaagcctgctcaaggttttgtccgccaag
gaaaaggtcgggctggacaagaaacgcttcgccgacctggaagccatcggcgacgtggtg
gattctcccgaggcgaatgaaaaggcgcaggagatcgcggaacatgcggtcactctggtg
cgcaacaactcgaacatgattccgctggcggcgccggacagggcttgctatgtgatcatg
ccggagagccggttcggctccgaaggccaggcgtacacgcaggagcttcgcaagacggta
gcgcgcgccaccgtggtcagctgggatgcgacgctgtcgcgccagcagctggatgacggc
gtgagcaaactctcgggatgcgagagctatgtggtggcggcattcacttccgtgggggcg
tatcgaggcacggtgggaatgctgggcggggaactgccgcacgcgttggaaggcttgatg
gcaacgggcaaaccagtggcgctgatcgctctcggcaatccgtacgtgctgcgcaacttc
ggcaacgtgacttcctaccttgcgaccttcagcaacgtgccgccgtgcgaaatcgccgcg
gtgcgagcggtgctggggcagatcccgattcgcggccatctgccggtgacgattccggga
caggcaaaatacggcgatggaatccagttgccggccgcgcatccgatccgggtatccggc
gcttcccagtaa

DBGET integrated database retrieval system