KEGG   Candidatus Solibacter usitatus: Acid_2220Help
Entry
Acid_2220         CDS       T00412                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sus  Candidatus Solibacter usitatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acid_2220
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Acid_2220
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acid_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2842458..2844269
Genome map
AA seq 603 aa AA seqDB search
MLVLAAATSAGPARSESARKAAATKSVAAKSAPLKASPTVRRWMKTMTLRDEIAQLIFIA
FHGAAPNSRSREYRNFMHQIRDNKVGGLILVNWSNGRVIQKAEPYAVAAFLNRMQRLAKT
PLMVSGDFERGASMRVDGTTVFPHAMAFGATGDPAYSRYEGEVTAREARALGVQWLYYPV
ADVNNNPDNPIINIRSFGENPEAVAAQVVAFVQGAHADKKNYALATVKHFPGHGDTAVDS
HMNMPTITADRERLNHIELVPFKAAIDAGVDSVMTAHIAVPALSPPDLPSTLSPAILTDL
LKKELGFKGIVVTDALEMAGIAKGFSTGDAAVRALEAGADVLLMPTDPDAVIKAVAAAVQ
SGRLTRQRIQESLLKVLSAKEKVGLDKKRFADLEAIGDVVDSPEANEKAQEIAEHAVTLV
RNNSNMIPLAAPDRACYVIMPESRFGSEGQAYTQELRKTVARATVVSWDATLSRQQLDDG
VSKLSGCESYVVAAFTSVGAYRGTVGMLGGELPHALEGLMATGKPVALIALGNPYVLRNF
GNVTSYLATFSNVPPCEIAAVRAVLGQIPIRGHLPVTIPGQAKYGDGIQLPAAHPIRVSG
ASQ
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcctagccgcggctacgagtgcgggaccagcgcgttccgagtccgcccgtaag
gcggcagcgacaaaatcggtcgccgcgaaatcggcgccgctgaaggcatcccccaccgtg
cggcggtggatgaagacgatgacgctgcgcgatgagatcgcgcaattgattttcatcgca
ttccatggggcggcgcccaattcccgttcgcgcgaatatcgaaatttcatgcaccagatc
cgcgataacaaggttggcggactgatcctggtgaactggtcgaacggacgcgtcattcag
aaggcggagccctacgcggtggcggcattcctcaatcgcatgcagcggctcgcgaagacg
ccattgatggtcagcggcgatttcgagcgcggcgcctccatgcgggtggatggcaccact
gtgttcccgcatgcgatggccttcggcgcaaccggggaccccgcgtactcgcggtatgaa
ggcgaagtgacggcgcgcgaggcgcgcgctcttggggttcaatggctctactatccggta
gccgatgtgaacaataaccccgacaatccgatcatcaacatccggtccttcggcgaaaat
cccgaggccgtggcggcgcaggtggtcgcatttgtccagggagcgcacgcggataagaag
aactacgcgctggccaccgtgaaacatttcccgggccacggcgacacggccgtggacagc
cacatgaacatgcccacgatcacggccgaccgcgagcggttgaaccacatcgagctggtg
cccttcaaggcggcgatcgatgccggcgtggattcggtgatgacggcgcacatcgcggtg
cctgcgctttcgccgcctgacctgccctccacgctgtcacccgcgattcttaccgacctg
ctgaagaaggagctcggcttcaaaggcatcgtggtcacggacgccctggagatggccggc
atcgccaaaggctttagcaccggcgacgcggcagtgcgcgcgctggaggcgggagccgac
gtgctgttgatgccgaccgaccccgatgcggtgatcaaagccgtggccgccgccgtacag
agcggacgcctgacgcgccagcggattcaggaaagcctgctcaaggttttgtccgccaag
gaaaaggtcgggctggacaagaaacgcttcgccgacctggaagccatcggcgacgtggtg
gattctcccgaggcgaatgaaaaggcgcaggagatcgcggaacatgcggtcactctggtg
cgcaacaactcgaacatgattccgctggcggcgccggacagggcttgctatgtgatcatg
ccggagagccggttcggctccgaaggccaggcgtacacgcaggagcttcgcaagacggta
gcgcgcgccaccgtggtcagctgggatgcgacgctgtcgcgccagcagctggatgacggc
gtgagcaaactctcgggatgcgagagctatgtggtggcggcattcacttccgtgggggcg
tatcgaggcacggtgggaatgctgggcggggaactgccgcacgcgttggaaggcttgatg
gcaacgggcaaaccagtggcgctgatcgctctcggcaatccgtacgtgctgcgcaacttc
ggcaacgtgacttcctaccttgcgaccttcagcaacgtgccgccgtgcgaaatcgccgcg
gtgcgagcggtgctggggcagatcccgattcgcggccatctgccggtgacgattccggga
caggcaaaatacggcgatggaatccagttgccggccgcgcatccgatccgggtatccggc
gcttcccagtaa

DBGET integrated database retrieval system