KEGG   Candidatus Solibacter usitatus: Acid_2353Help
Entry
Acid_2353         CDS       T00412                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sus00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2999326..2999940)
Genome map
AA seq 204 aa AA seqDB search
MHTTTVYIISAPSGSGKSTLVARLLESVPNLMFSVSYTTRPPRGVEVEGAEYRFVTREEF
EAMLAGDEFLEWAEVFGNYYGTHRCILEEARKQGKDLVLDIDVQGARQLIEKIPQAVTIF
VLAPSRQVLEQRLRSRGEDREEVIKRRLRAAAEEIRNYEAYDYVLINRELSEAEATLCGI
IRAERARRTRIEDQLRPILDTFQS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgaccaccgtctacatcatttccgccccttccggctccggcaaatcgacgctg
gtcgcacgcctgctcgagtccgttccgaacctgatgttctccgtgtcctacaccacccgc
ccgccccgcggcgttgaggtggagggcgcggagtatcgctttgtgacccgcgaggaattc
gaggcgatgctggccggcgacgagtttctcgaatgggctgaagtatttggcaactattac
ggcacccaccgctgcattctggaggaggcccggaagcaggggaaagacctggtactcgac
atcgatgtccaaggtgcgagacaattgatagagaagattccgcaggccgtaaccattttc
gtcctggccccttcgcggcaggtcctcgaacagaggctgcgttcgcgaggcgaagaccgc
gaagaagtgatcaagcggcggctcagggcggcggcggaagagatccggaattacgaggct
tacgattacgttttgattaaccgggagctgtccgaagccgaggcaaccttgtgcggcatt
atccgcgccgaacgcgcgcggcggacccgaatcgaagatcagctccggcccatattagac
acttttcaaagttga

DBGET integrated database retrieval system