KEGG   Candidatus Solibacter usitatus: Acid_2606Help
Entry
Acid_2606         CDS       T00412                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid_2606
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acid_2606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3287735..3289441
Genome map
AA seq 568 aa AA seqDB search
MILKNSAALLLFCAAAGVAADATPAIKVDQVGYLTAAPKVAFVAAPAAALEFTVRRAADA
SVVFTGPLSAPHEDPDSGDRVQSADFSKLTTPGAYYLNVPTIGRSWEFAIGPDVYSRAWY
LATRSYYGQRCGIAVDLGSEFPGFRHDTCHLEGAFHASSGKTGAHISHGGWHDAGDYGRY
VVNSGISTGTLLWTWELYGPKLRAVKLNLPESGNGTPDLLNEIRWNLEWMLTMQDDDGGV
WHKQTSDRFCGFVMPEKDKLVSYVIGSGAEPFKTSCATGDLAAVMAIAARAYKPYDATFA
AKCLRAAQKAWTWLDKFPNATFRNPQGVSTGAYGDGNCADERLWAAAELFRTTASADYER
YFLDHYTALQSGIRAAGPQSWPSVGNLALWTYVLGAGKNADAVAAIRAASLAAAGQIVER
TAANPYRVSLTTRDYIWGSNAVAANYGMQLLIANAFAPDPRYVETALDNLHYLLGRNTFS
LSFVTRVGDNPFRHPHHRPSGADANAEPWPGLLSGGPNHGRQDDAMRKIPADTPPAKCYL
DDQEAYSANEVAINWNAPLVFLLAGALK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgaaaaatagcgccgcgctcctgctgttctgcgccgccgcgggcgtggccgcc
gatgccacgcccgccatcaaagtcgatcaggtaggttacctgactgccgcgcccaaagtt
gccttcgtcgccgcccccgccgccgccctggaattcaccgtccggcgcgccgccgatgcg
tcggtcgtcttcaccggccctctctccgcgccccacgaagaccccgattccggcgaccgc
gtccagtccgccgatttctccaaactcaccacacccggcgcctactacctcaacgtcccc
accatcggccgtagctgggaattcgccatcggccccgatgtctactcacgcgcctggtat
ctcgccacccgctcctactacggtcagcgctgcggaatcgccgtcgatctcggctccgaa
tttcctggcttccggcacgacacctgccacctcgaaggcgcctttcacgcctcctccggc
aagaccggcgcccacatctcgcacggcggctggcacgatgccggcgattacggccgctac
gtcgtcaactccggcatctctaccggcactctcctttggacctgggaactctacggcccc
aaactccgcgccgtcaaactcaacctccccgaatccggcaacgggacccccgacctgctc
aacgaaatccgctggaaccttgagtggatgctcaccatgcaggatgacgatggcggtgtc
tggcacaaacaaaccagcgatcgtttctgcggcttcgtcatgcccgaaaaagacaagctg
gtgagctacgtaatcggcagcggcgccgagcccttcaaaacctcctgcgccaccggtgat
ctcgccgccgtcatggccatagccgcccgcgcctacaaaccgtacgacgcgaccttcgcg
gccaaatgtctccgcgccgcccaaaaagcctggacctggctcgacaaattccccaacgcc
accttccgcaatccccagggtgtctccaccggcgcctatggcgatggcaactgcgccgac
gagcggctctgggccgccgccgagctcttccgcaccaccgcctccgccgactacgaacgc
tacttcctcgatcactacaccgccctccaaagcggcatccgcgccgccggaccgcaatcc
tggcccagcgtcgggaatctcgctctctggacctatgtcctcggcgcgggcaagaatgcc
gatgccgtcgccgccattcgcgccgcctccctcgcggccgccggacagatcgtcgagcgc
accgccgccaatccctaccgcgtcagcctcaccacccgcgactacatctggggctccaac
gccgttgccgccaactacggtatgcaactcctgatcgccaacgccttcgccccggatcca
cgctacgtcgagactgcgctcgacaatctccactacctgctcggccgcaataccttctcg
ctctctttcgtcacccgcgttggcgataatcccttccgccatcctcaccaccgccccagc
ggcgccgacgccaatgccgaaccctggccgggcctgctctccggcggccccaatcacggc
cgccaggacgatgccatgcgcaaaatccccgccgatactccgcccgcgaaatgctacctc
gacgatcaggaggcctactccgccaacgaggtcgccatcaactggaatgcgcccctggtc
ttccttcttgccggcgcgctcaaatga

DBGET integrated database retrieval system