KEGG   Candidatus Solibacter usitatus: Acid_2638Help
Entry
Acid_2638         CDS       T00412                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sus00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sus00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3337839..3339230
Genome map
AA seq 463 aa AA seqDB search
MKALIAILGLASFMAGGQQGSDAEVWLTTPDKSALFERQKQSPVLAAPGSRNPTIEIDER
QKFQPIDGFGFALTGGSAQHLVRMSAAARAAILKELFGTADREIGVSYLRLTIGASDLND
HVFTYDDMPDGQTDPDLQHFDLGPDKADVIPVMKEILKLNPRIKILASPWTAPSWMKTNN
NAKGGALKPEAYPAYAQYFVKYIRAMKAEGIAIDAITVQNEPLNPKNTPSLVMQSAEEAL
FIKSHLGPAFHAAGIKTHIVLYDHNCDVPEYATAILADRAAARYVDGSGFHLYGGKIEAM
TQVHDQYPVKNLYFTEQMVVGSVESKPAINIAAPVRRLIIGATRNWSRNVVLWNLAADPK
NNPHTDDGGCGMCQGAITIDGDQVSRNLAYYAIAHASKFVRPGAVRIASTSLESLPNVAF
RTPSGKRVLIVVNASQTSQTFDIQAAKRMSATLPPGAVATYVW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccctgatcgccatcctcgggctcgcctcctttatggccggcggccaacaaggc
agcgacgcggaagtctggctcaccactccggacaaatctgcgctcttcgaacggcagaag
cagtcgcccgtcctagccgcccccggcagcaggaatcccaccatcgagatcgacgagcgg
cagaagtttcagcccatcgatggcttcggcttcgccctcaccggcggcagcgcgcagcac
ctcgtccgcatgagcgccgccgcgcgcgccgccattctcaaagagctgttcggcaccgcc
gatcgcgagatcggcgtgagctatctgcgtctcaccatcggcgcgtccgatttgaacgac
cacgtcttcacgtacgacgacatgccggacggccagaccgaccccgacctccagcacttc
gatctcggacccgacaaagccgacgtcatcccggtgatgaaggagatcctcaagctcaat
ccgcgcatcaaaatccttgcctcgccgtggaccgcgccttcgtggatgaagaccaacaac
aacgcgaagggcggcgcgctcaagcccgaagcctaccccgcctacgcgcaatacttcgtc
aaatatatccgcgccatgaaagccgaaggcatcgctatcgatgccatcacggtgcagaac
gagccgctcaatcccaagaacacgcctagcctcgtcatgcagtccgccgaggaagcgctc
ttcatcaagagccatctcggtcccgcatttcacgccgcgggcatcaagacccatatcgtg
ctctacgaccacaattgcgacgtccccgaatacgccaccgcgatcctcgccgatcgcgct
gcggcccgctacgtcgatggctccggtttccacctctacggcggcaagatagaggccatg
acccaggttcacgaccagtatccggtgaagaatctctacttcacggaacagatggtggtc
ggctcggtggagagcaagcccgccatcaacatcgccgcgccggtgcgccgcctgatcatc
ggcgccacccgcaactggagccggaacgtcgtgctgtggaacctcgccgccgacccgaag
aacaatccgcacaccgacgatggcggctgcggtatgtgccagggcgccatcacgatcgat
ggcgaccaggtaagccgcaacctggcatactacgccatcgcccatgcctctaaattcgtg
cgccctggcgccgtgcggatcgcttccaccagcctggagtcgctccccaacgtcgccttc
cggactccctccggcaagcgcgtcctgatcgtagtcaacgcgagtcaaacgtcgcagacc
ttcgatatccaggccgcgaaacgaatgtccgcgaccctccctcccggcgccgtcgcaacg
tatgtctggtag

DBGET integrated database retrieval system