KEGG   Candidatus Solibacter usitatus: Acid_2638Help
Entry
Acid_2638         CDS       T00412                                 

Definition
(GenBank) Glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00511  Other glycan degradation
sus00600  Sphingolipid metabolism
sus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Acid_2638
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid_2638
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Acid_2638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: ABJ83627
JGI: Acid2638
UniProt: Q024E9
Position
3337839..3339230
Genome map
AA seq 463 aa AA seqDB search
MKALIAILGLASFMAGGQQGSDAEVWLTTPDKSALFERQKQSPVLAAPGSRNPTIEIDER
QKFQPIDGFGFALTGGSAQHLVRMSAAARAAILKELFGTADREIGVSYLRLTIGASDLND
HVFTYDDMPDGQTDPDLQHFDLGPDKADVIPVMKEILKLNPRIKILASPWTAPSWMKTNN
NAKGGALKPEAYPAYAQYFVKYIRAMKAEGIAIDAITVQNEPLNPKNTPSLVMQSAEEAL
FIKSHLGPAFHAAGIKTHIVLYDHNCDVPEYATAILADRAAARYVDGSGFHLYGGKIEAM
TQVHDQYPVKNLYFTEQMVVGSVESKPAINIAAPVRRLIIGATRNWSRNVVLWNLAADPK
NNPHTDDGGCGMCQGAITIDGDQVSRNLAYYAIAHASKFVRPGAVRIASTSLESLPNVAF
RTPSGKRVLIVVNASQTSQTFDIQAAKRMSATLPPGAVATYVW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccctgatcgccatcctcgggctcgcctcctttatggccggcggccaacaaggc
agcgacgcggaagtctggctcaccactccggacaaatctgcgctcttcgaacggcagaag
cagtcgcccgtcctagccgcccccggcagcaggaatcccaccatcgagatcgacgagcgg
cagaagtttcagcccatcgatggcttcggcttcgccctcaccggcggcagcgcgcagcac
ctcgtccgcatgagcgccgccgcgcgcgccgccattctcaaagagctgttcggcaccgcc
gatcgcgagatcggcgtgagctatctgcgtctcaccatcggcgcgtccgatttgaacgac
cacgtcttcacgtacgacgacatgccggacggccagaccgaccccgacctccagcacttc
gatctcggacccgacaaagccgacgtcatcccggtgatgaaggagatcctcaagctcaat
ccgcgcatcaaaatccttgcctcgccgtggaccgcgccttcgtggatgaagaccaacaac
aacgcgaagggcggcgcgctcaagcccgaagcctaccccgcctacgcgcaatacttcgtc
aaatatatccgcgccatgaaagccgaaggcatcgctatcgatgccatcacggtgcagaac
gagccgctcaatcccaagaacacgcctagcctcgtcatgcagtccgccgaggaagcgctc
ttcatcaagagccatctcggtcccgcatttcacgccgcgggcatcaagacccatatcgtg
ctctacgaccacaattgcgacgtccccgaatacgccaccgcgatcctcgccgatcgcgct
gcggcccgctacgtcgatggctccggtttccacctctacggcggcaagatagaggccatg
acccaggttcacgaccagtatccggtgaagaatctctacttcacggaacagatggtggtc
ggctcggtggagagcaagcccgccatcaacatcgccgcgccggtgcgccgcctgatcatc
ggcgccacccgcaactggagccggaacgtcgtgctgtggaacctcgccgccgacccgaag
aacaatccgcacaccgacgatggcggctgcggtatgtgccagggcgccatcacgatcgat
ggcgaccaggtaagccgcaacctggcatactacgccatcgcccatgcctctaaattcgtg
cgccctggcgccgtgcggatcgcttccaccagcctggagtcgctccccaacgtcgccttc
cggactccctccggcaagcgcgtcctgatcgtagtcaacgcgagtcaaacgtcgcagacc
ttcgatatccaggccgcgaaacgaatgtccgcgaccctccctcccggcgccgtcgcaacg
tatgtctggtag

DBGET integrated database retrieval system