KEGG   Candidatus Solibacter usitatus: Acid_2800Help
Entry
Acid_2800         CDS       T00412                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus00220  Arginine biosynthesis
sus00330  Arginine and proline metabolism
sus01100  Metabolic pathways
sus01110  Biosynthesis of secondary metabolites
sus01130  Biosynthesis of antibiotics
sus01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Acid_2800
   00330 Arginine and proline metabolism
    Acid_2800
Enzymes [BR:sus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Acid_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABJ83786
JGI: Acid2800
UniProt: Q023Q4
Position
complement(3547855..3548769)
Genome map
AA seq 304 aa AA seqDB search
MPRSHIAIIGAPLDLGQDRRGVDMGPSALRVASLNARIASLGYEVEDWGNIHVEQKEALP
EGHPRAKYLVQIAAASKLLAARVDDALTQSLMPLVLGGDHSVAIGTVTGVARHYRDRGQS
IGLIWLDAHADMNTPDSSPSGNIHGMPLACIVGCGPPELADLGGFRPKVAPCNTVIVGLR
DVDAAEKPQVRDSGVRAFTMRDIDERGLRAVMDEAIRAASDGTAGIHLSLDMDFCDPADA
PGVGTPVRGGATYREAHLAMEMICDSRRVMSMEVVEVNPVIDEKNRTADFAVELIMSGLG
KRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgctcgcacatcgccattatcggcgcgcctctcgacctgggccaggaccgccgc
ggcgtcgatatgggcccctccgccctccgcgtcgcctccctcaacgcgcggatcgcctcc
ttgggctatgaagtcgaggattggggcaacattcacgtcgagcaaaaggaagccctgccc
gaaggccacccacgcgccaagtaccttgtacagatcgccgccgccagcaagctcctggcc
gcgcgcgtggatgacgccctcacccaatccctgatgcctctggtcctcggcggcgatcac
tccgtcgccatcggcaccgtcaccggcgtcgcccgccactaccgcgaccgcggccaatcc
atcggcctcatctggctcgacgcccatgccgacatgaatactccggacagcagtccaagc
ggcaacatccacggcatgccgctcgcctgcattgtcggctgtggtcccccggaactcgca
gatctcggcggcttccgccccaaggtcgcgccatgcaacaccgtcatcgtcggcctccgc
gatgtcgacgccgccgagaagccccaggttcgcgactccggtgtccgcgccttcaccatg
cgcgatatcgatgagcgcggcctccgcgccgtaatggatgaagccatccgcgcggcctcc
gatgggaccgccggaatccacctttcgctcgacatggatttctgcgaccccgccgatgcc
ccgggcgtcggcaccccggttcgcggcggcgcaacgtaccgcgaagcgcatttggcaatg
gaaatgatctgtgattcgcggcgcgtgatgtcgatggaggtggtcgaggtgaatcccgtt
atcgacgagaagaaccgcactgccgatttcgccgtcgagctcatcatgtccggactagga
aaacgtatcttatga

DBGET integrated database retrieval system