KEGG   Candidatus Solibacter usitatus: Acid_2800Help
Entry
Acid_2800         CDS       T00412                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sus01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sus00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3547855..3548769)
Genome map
AA seq 304 aa AA seqDB search
MPRSHIAIIGAPLDLGQDRRGVDMGPSALRVASLNARIASLGYEVEDWGNIHVEQKEALP
EGHPRAKYLVQIAAASKLLAARVDDALTQSLMPLVLGGDHSVAIGTVTGVARHYRDRGQS
IGLIWLDAHADMNTPDSSPSGNIHGMPLACIVGCGPPELADLGGFRPKVAPCNTVIVGLR
DVDAAEKPQVRDSGVRAFTMRDIDERGLRAVMDEAIRAASDGTAGIHLSLDMDFCDPADA
PGVGTPVRGGATYREAHLAMEMICDSRRVMSMEVVEVNPVIDEKNRTADFAVELIMSGLG
KRIL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgctcgcacatcgccattatcggcgcgcctctcgacctgggccaggaccgccgc
ggcgtcgatatgggcccctccgccctccgcgtcgcctccctcaacgcgcggatcgcctcc
ttgggctatgaagtcgaggattggggcaacattcacgtcgagcaaaaggaagccctgccc
gaaggccacccacgcgccaagtaccttgtacagatcgccgccgccagcaagctcctggcc
gcgcgcgtggatgacgccctcacccaatccctgatgcctctggtcctcggcggcgatcac
tccgtcgccatcggcaccgtcaccggcgtcgcccgccactaccgcgaccgcggccaatcc
atcggcctcatctggctcgacgcccatgccgacatgaatactccggacagcagtccaagc
ggcaacatccacggcatgccgctcgcctgcattgtcggctgtggtcccccggaactcgca
gatctcggcggcttccgccccaaggtcgcgccatgcaacaccgtcatcgtcggcctccgc
gatgtcgacgccgccgagaagccccaggttcgcgactccggtgtccgcgccttcaccatg
cgcgatatcgatgagcgcggcctccgcgccgtaatggatgaagccatccgcgcggcctcc
gatgggaccgccggaatccacctttcgctcgacatggatttctgcgaccccgccgatgcc
ccgggcgtcggcaccccggttcgcggcggcgcaacgtaccgcgaagcgcatttggcaatg
gaaatgatctgtgattcgcggcgcgtgatgtcgatggaggtggtcgaggtgaatcccgtt
atcgacgagaagaaccgcactgccgatttcgccgtcgagctcatcatgtccggactagga
aaacgtatcttatga

DBGET integrated database retrieval system