KEGG   Candidatus Solibacter usitatus: Acid_2892Help
Entry
Acid_2892         CDS       T00412                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acid_2892
Enzymes [BR:sus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Acid_2892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3666619..3668163)
Genome map
AA seq 514 aa AA seqDB search
MEPDNRPEIAPLFPADYRGSGLLLHIASLPGPFGIGDVGPSAFQWVDRLQAAGQQWWQAL
PLGPTGHRDSPCQCGSSFAANPLLISPKSLIDDELLRAADCQGYSFPSASVDYDTVVPLK
HRLLHLAWANFKAGARPDLTPPFEQFCDAQSIWLDDYALFRALHQKFGGVHYLQWPQPLV
FREPAALEEARRELADQMERVAFEQFLLFRRGVTLKDYAHSRGIRLIGDLSFFVEPNSSD
VWSRPEYFLLDENRRPRSVSGVPPDAVSSLGQVWGSPVYNWNALRETGFRWCIDRFQALL
AHVHVIRLDHFRGFAAAWHVPVGAPSARCGQWVQGPGAQLFAAVEDSLGSLPFIADDLGM
ITADVRHLLDQLESPGTRVLQFAFDGHSDNPHLPVNYLPNTVVYTATHETAATRTWFEKL
SPNERRNLWRHLRRPSGEAADAAPALMGLASSSRAALAMAPLQDLLNLPGAPAPWRWRAT
EDMLNAHAFDWLRQLTKATKRLPPPFELQLQEIA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagacaatcgccctgaaatcgcacccctgttcccggctgattaccgcggctcc
ggactgctcctgcacatcgcgtccctgcccgggcccttcggcatcggcgacgtcggcccc
tctgcctttcaatgggtcgaccgcctccaggcagccggacagcaatggtggcaggcactc
ccgctcggccccaccggccatcgcgattcgccatgccagtgcggctcctcctttgccgcc
aaccctctcctcatcagtcccaagtccctgattgatgacgagctcttgcgcgctgccgat
tgtcagggttattcgtttccctccgcctcggtcgattacgacactgtcgttccattgaaa
caccgcctcctccatctcgcctgggccaatttcaaagccggcgcccgccccgatttgacc
ccgcccttcgagcaattctgcgacgcccaatccatctggctcgatgactacgctctcttc
cgcgccctgcatcagaaatttggcggcgtccattacctgcaatggcctcagccgctggtc
ttccgcgaacctgccgccctggaagaagcgcgccgcgagttggcagaccagatggaacgc
gtcgccttcgaacagtttctgctcttccgccgcggcgtcacgctcaaagactacgcccac
tcccgaggcatccggctaatcggcgacctctcgtttttcgtcgaacccaattccagcgat
gtctggtcccgccccgagtatttcctcctcgatgaaaaccgccgtccccgctctgtctcc
ggagtgcccccggatgccgtcagttccctcggccaagtctggggcagtccggtctacaac
tggaacgctctccgtgaaaccggcttccgctggtgcatcgatcgcttccaggcattgctc
gcccacgtccatgtcatccgcctcgatcacttccgcggcttcgccgccgcctggcatgtc
cccgtcggtgcgcccagtgcgcgctgcgggcaatgggtccagggacccggcgcgcagtta
ttcgcggccgtcgaagactcactcggctccctgcccttcatcgccgacgacctgggaatg
atcaccgccgacgtccgccatctcctcgatcaactcgaatcccccggcacccgcgtcctt
cagttcgccttcgatggccactccgataatccccacttgcccgtcaactacctgcccaac
actgtcgtctataccgccacccacgaaaccgccgccacccgcacctggtttgaaaaactc
tcccccaacgagcgccgcaacctgtggcgccatctccggcgccccagcggtgaagccgcc
gatgccgctcctgccttgatgggcctggcctcgtcctcccgcgccgcacttgccatggct
cctcttcaggacctgctcaacctgcccggcgctcccgccccctggcgctggcgcgccacc
gaagacatgctcaatgcccacgccttcgattggctgcgccagctcaccaaggccaccaaa
cgcctgccccctccgttcgaactccaactccaggagatcgcctga

DBGET integrated database retrieval system