KEGG   Candidatus Solibacter usitatus: Acid_3107Help
Entry
Acid_3107         CDS       T00412                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_3107
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acid_3107
   00630 Glyoxylate and dicarboxylate metabolism
    Acid_3107
Enzymes [BR:sus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acid_3107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3937415..3939016
Genome map
AA seq 533 aa AA seqDB search
MSSGTMQAPKGTEIQGLVEGEHAGILTREAIEFIAGLSRHFEPRRRELLARRAERQLALD
AGARPDFLPETAEIRAGEWRVAPIPKDLEDRRVEITGPVDRKMIINALNSGANVFMADFE
DSNSPTWRNNLDGQVNLRDAVRGTIAFESGEGKQYRLNPRPAVLFVRPRGWHLTERHFLV
DGEPISGSLFDFGLYFFHNARALMEKGSGPYFYLPKMESHLEARLWNDVFTAAQDALRIP
RGTIRATVLIETILAAFEMDEILWELRDHSAGLNCGRWDYIFSFIKKFRNREGFVLPNRA
VVTMDRHFLDSYVRLLIETCHRRGIHAMGGMAAQVPIKDDRAANEQAIEKVRRDKIREVR
AGHDGTWVAHPGLVPVAKQVFDEVLKEPNQIAIKRDDARVVAVDLLAIPDGEITEQGVRW
NIDVGLRYLEAWLRGSGCVPIYNLMEDAATAEICRAQIWQWVRHGAALQDGRKVTAAWVL
QACAEQLQKIREDLGDAAFSQGRFAEAARIFEPMVTGSEFPEFLTLAAYASID
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtggaaccatgcaggcgccaaagggcacggaaattcaggggcttgtggaaggc
gaacacgccgggatcctgaccagggaagcaatcgagttcatcgccggtctctcgcggcat
ttcgaaccccggcggcgtgaattgctcgcccgcagagcggaacgccagttggcgctcgac
gcaggcgcgcgaccggattttcttccggaaacggcggagattcgggccggcgagtggcgg
gtcgcgccgattccgaaggatctcgaagaccggcgcgtcgagatcaccgggcccgtcgat
cgcaagatgatcatcaatgcgctcaactccggcgccaatgtgttcatggcggatttcgag
gattccaactcgcccacctggcgcaacaacctggatgggcaggtgaacctgcgcgacgcc
gtccgcggcacaatcgcgttcgagagcggggaagggaagcagtaccggcttaatccccgt
cccgcagtcctgttcgtgcggccgcgaggctggcatttgacggagcggcactttttggtg
gacggcgagccgatctccggttcgcttttcgatttcggcctctacttctttcacaacgcg
cgggcactgatggaaaagggatcgggaccatatttttatctgcccaagatggaaagccat
ctcgaagcgcgcttgtggaacgatgtcttcaccgcggctcaggatgccttgcgcattccg
cgcggcaccattcgagctaccgtgttgatcgagactatactcgctgcattcgagatggac
gaaatcctctgggaactgcgcgatcattccgccgggctgaactgcgggcggtgggactac
attttcagcttcattaagaagttccgcaaccgggaaggtttcgtgctgcccaatcgagca
gtggtgacgatggaccggcattttctggattcctacgtccgcctgctgattgagacgtgc
caccgccgcggtatccacgcgatgggcggtatggcggcgcaggtaccgatcaaagatgat
cgggcggccaatgagcaggccatcgaaaaggtccgccgcgacaagatccgcgaggtgcgc
gcgggacatgacggaacctgggtggcgcatccgggactggtaccggtcgcgaaacaggtc
ttcgacgaagtcttgaaagagccgaatcagatcgccatcaagcgcgacgacgcgcgcgtc
gtcgccgtcgatctgctcgccattcccgacggtgaaattaccgaacagggcgtgcggtgg
aatatcgacgtgggcctgcgctatctggaggcgtggctgcgcggctccggttgcgtgccg
atctacaacctgatggaagacgcggccaccgccgagatctgccgggcccagatctggcag
tgggttcgtcacggcgccgctttgcaggatggccgaaaggtcacggcggcctgggtgctg
caggcgtgcgcggagcagttacagaagattcgcgaggatctgggggacgccgccttctcg
cagggccgcttcgcggaggctgcccgcattttcgagccgatggtgacgggatctgaattt
ccggagttcctgacgctggcggcttacgcgtctatcgattga

DBGET integrated database retrieval system