KEGG   Candidatus Solibacter usitatus: Acid_3181Help
Entry
Acid_3181         CDS       T00412                                 

Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Acid_3181
Enzymes [BR:sus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Acid_3181
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Acid_3181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4030589..4032073
Genome map
AA seq 494 aa AA seqDB search
MKGKVYLVGAGPGDPELITVKGRRVLQGADAVLYDHLAAAALLDLAPAHAERVYVGKKKS
AHEFTQEEICAMLIERGRRGLTVVRLKGGDPFIFGRGGEEAEALADAGIAFEVVPGVTTP
LGIAAYTGVPLTHREHTSAVTFVTGHAVQAIDWDKVGHAETLVIFMGLTTFPEIARELIA
RGRPAETPAMAVRWATRADQETVVGTLGTLTGMLAGMKPPATIVVGEVVRLREKLDWYGR
LPLAGKRIVVTRAREQADALGAALSSLGAGVIELPTIEIGPAADSGPLERAIAELETYDW
LIFTSANGVRFFVERLDDLRKLRSKICAIGPATRAAVEALHVKVDLMGKEYVAEGLLEAF
AAHDLAGKRVLLPRAAVARDLVPVELAKRGAQVDVVEAYRTAAPAGLGARVREVFARRPD
CVTFTSSSTVRNFVEAAGAGALEGVRVASIGPVTSATARELGVAVTVEARPFTVDGLVDA
VLELYTEMTPPSTE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaaggtgtatctggtgggggcggggccgggggatccggaactgattacggtg
aaggggcgaagggtcctgcaaggggcggatgcggtgctgtacgatcacctggcggccgcg
gccctgctcgacctcgcccccgctcacgcagagcgggtctacgtcggcaagaagaagtcg
gcgcacgagttcacgcaggaagagatttgcgccatgctgatcgaacgcgggcggcgcggg
ctgacagtggtgcggctgaagggtggcgacccgtttattttcgggcgcggcggggaagag
gcggaggcgctggcggatgcggggatcgcgttcgaagtggtgccgggggtgaccacgccg
ctgggcatcgcagcctacaccggcgtgccgctgacacatcgcgaacacacctcggcagtg
acgttcgtgaccgggcacgcggtgcaggcgatcgattgggacaaagtgggacacgccgag
acgctggtgatcttcatggggctgaccacgttcccagagatcgcgcgtgaattgatcgcg
cggggccggccggcggagactccagcgatggcggtgcgttgggccacgcgggcagaccag
gagacggtggtcggcacgctgggaacgctgaccggaatgctggccgggatgaagccgccg
gcaaccatcgtggtgggcgaggtggtgcggctgcgcgagaagctggattggtacggacgg
ctgccgcttgcgggaaagcggatcgtggtgacgcgggcgcgggaacaggcggacgcgctg
ggcgccgcgttgagctcgctgggtgcgggcgtgatcgagctgccgacgatcgagatcggt
ccggcggcggatagcggcccgctggagcgcgcgatcgcggagttggaaacctacgactgg
ctgatcttcacgagcgccaacggagtgcggtttttcgtggagcggctcgacgatctgcgc
aagctgcgctcgaagatctgcgcgatcggcccggcgacgcgggcggcggtggaagcgctc
cacgtgaaggtggacctgatgggcaaggaatacgtcgcggaggggctgctcgaagccttc
gcggcgcacgacctggcgggcaagcgggtgctgctgccgcgggcggcggtggcgcgcgac
ctggtgccggtggaactggcgaagcgcggcgcgcaggtggatgtggtggaagcgtaccgg
acggcggctccggcggggctgggggcgcgggtgcgggaagtcttcgcgcggcggccggat
tgcgtcacgttcacgagctcttccacggtccggaatttcgtggaggcggccggagcaggg
gcgctcgaaggcgtacgggtggcgtctatcgggccggtcacgtcggccacggcccgggaa
ctcggagtggcggtaacggtggaagcgcggccatttacggtggatggacttgtcgatgca
gtgctcgagttgtacactgaaatgactcccccgtcaactgaatga

DBGET integrated database retrieval system