KEGG   Candidatus Solibacter usitatus: Acid_3378Help
Entry
Acid_3378         CDS       T00412                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_3378 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acid_3378 (sucC)
   00640 Propanoate metabolism
    Acid_3378 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Acid_3378 (sucC)
Enzymes [BR:sus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acid_3378 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4278829..4279983)
Genome map
AA seq 384 aa AA seqDB search
MKIHEYQAKAILAQYKVPVPRGHVAYTEADAETAAKTLGGSVVVKAQIHAGGRGKGGGVK
VAKDAAEALELAKKILGMTLVTHQTGPEGRLVQRLLIEETLPIERELYLGIVLDRVQGKP
VFMASSAGGMDIEEVAAKTPELILKETLEYPGLSPYQARKLAFGIGIPAASVNAAAAAMT
ALSKAYWAMDASLAEINPFILTTDGKVYALDAKITFDDNALYRHKELVELRDLNEEDPLE
VEASKHGLNYIKLDGTVGCMVNGAGLAMATMDIIKFAGGSPANFLDVGGGANAEQVKNAF
RILLSDHSVKAVLINIFGGILRCDTLATGVVAAARDLNIQVPIVVRMEGTNVEAGRQILL
ESGFNFTVGADMWDAAQKVVKLAA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtatcaagccaaggccattctggcccaatacaaagtccctgtgcca
cgagggcatgtcgcatacacggaagcggacgcggaaaccgcggccaaaacgctgggcggc
tcggtggtggtgaaggcacagattcacgcgggcggccgcggcaaaggcggaggagtgaag
gtcgccaaagatgccgccgaagcgcttgaactggcgaagaagattctggggatgaccctg
gtcactcaccagaccggaccggaagggcggctggtgcagcgcctgctgatcgaagaaacg
ctgccgatcgaacgcgagttgtatctcggcatcgtgctggaccgggtgcagggcaagccg
gtcttcatggcgtcctcggcgggcggcatggacatcgaagaagtcgcggccaaaacgccg
gaactgatcctcaaggagacgctggagtatccgggcctctcgccctaccaggcgcgcaag
ctggcgtttggcatcggtatcccggcggcgagcgtgaatgcggcggcggcagcgatgacg
gcgctctccaaggcatactgggcgatggacgcgtcgctggcggagatcaaccccttcatc
ctgacgaccgacggcaaggtttacgcgctcgacgcgaagatcaccttcgacgacaacgcg
ctgtatcgccacaaagaactggtggagctgcgcgatttgaacgaggaagatccgctggag
gtggaagcctccaagcacggcttgaattacatcaagctggatggcacggtgggctgcatg
gtgaatggcgccggactcgcgatggcgaccatggacatcattaaattcgcgggcggcagt
ccggcgaacttcctggatgtgggcggcggggccaacgcggagcaagtgaagaacgcgttc
cggattctgctttcggatcacagcgtgaaggcggtgctgatcaacatcttcggcggcatt
ctgcgctgcgacacgctggccaccggcgtggtggcggcggcgcgcgacctgaacatccag
gtgccgatcgtggtgcgcatggaaggcaccaacgtggaagcgggccggcagattctgctg
gaatcgggattcaactttacggtgggcgcggacatgtgggacgccgctcaaaaagtagtg
aagctggctgcgtga

DBGET integrated database retrieval system