KEGG   Candidatus Solibacter usitatus: Acid_3851Help
Entry
Acid_3851         CDS       T00412                                 

Definition
imidazole glycerol phosphate synthase subunit HisH (EC:2.4.2.-)
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sus01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sus00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4886291..4886851)
Genome map
AA seq 186 aa AA seqDB search
MITILDYGAGNLRSVQNTLAELNCEYRLVNDAAGLQSATKILLPGVGHFGQMMHALDTLS
VREALVDRIRASVPFFGICLGMQALFESSEEAPEVRGLGLYPGIVRRFPMDARVPHMGWN
QLEPGGRYVYFAHSYYVPENQYTSAACTYGVRFTAMLQAGSVQGVQFHPEKSSTVGLQIV
KGFLEC
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccatcctcgattacggcgccggtaacctgcgcagcgtgcaaaacacgttggcc
gaattgaactgcgagtaccgcctggtcaacgacgctgccggcctgcaatctgcaaccaaa
attctcctccccggtgtcggccacttcggccagatgatgcacgcgctcgataccctgagc
gtgcgcgaagcgctggtcgatcgtattcgcgccagcgtcccgttcttcggcatctgtctc
ggcatgcaggcgctcttcgaatccagcgaagaggcccccgaggtccgcggcctcggcctt
taccccggcatagtccgccgcttcccgatggatgcgcgtgttccccacatgggttggaat
cagctggaacccggcggccgctacgtctacttcgcgcacagttactatgtccccgaaaat
cagtacacctccgccgcctgcacttacggcgttcgcttcaccgccatgctgcaagcgggc
agcgtacagggcgtccagttccaccccgaaaaatccagcacggtcggcctccagatcgtg
aaaggcttcctcgaatgttaa

DBGET integrated database retrieval system