KEGG   Candidatus Solibacter usitatus: Acid_4374Help
Entry
Acid_4374         CDS       T00412                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acid_4374
   01230 Biosynthesis of amino acids
    Acid_4374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acid_4374
  Energy metabolism
   00680 Methane metabolism
    Acid_4374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acid_4374
Enzymes [BR:sus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Acid_4374
Exosome [BR:sus04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Acid_4374
  Exosomal proteins of melanoma cells
   Acid_4374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5536569..5537315
Genome map
AA seq 248 aa AA seqDB search
MKKLVLIRHGESTWNKENRFTGWTDVDLSDEGRQQATEAAEVLKREGYVFDVAYTSVLKR
AIRTLWTVLDGMDLMWIPVHRSWRLNERHYGALQGLNKAETAAKFGEDQVKIWRRSYDIP
PPVLTADDPRFPGHDPRYQSLTKEELPLTECLKDTVARFLPLWHDTIAPAIRSGQRVIIA
AHGNSLRALVKYLDGVSEADIVELNIPTGMPLVYELDDDLKPLNRYYLGDPEKVKAAMEA
VAAQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaactcgttctcatccgccacggcgaaagcacgtggaacaaagaaaatcgcttc
accggctggaccgacgtcgatctctccgacgaaggccgccagcaggccaccgaagccgcc
gaggtgctcaaacgggaaggctacgtctttgacgtggcctacaccagcgtcctcaagcgc
gcgatccgcactctgtggacggtgctcgacggcatggacctgatgtggatcccggtgcac
cgctcctggcgcctgaatgaacgccactatggcgcgctgcagggccttaacaaggcggag
acggccgcgaagttcggcgaggaccaggtcaaaatctggcgccgcagctacgacatccca
ccgcccgtcctgaccgcggacgacccgcgcttccccggccacgacccgcgctaccagagc
ctcaccaaggaagagctcccgctcacggagtgcctgaaggacaccgtggcgcgcttcctt
cccttgtggcacgacaccatcgcgcccgcgatcaggagcggtcagcgcgtcatcatcgcc
gcccacggcaacagcctgcgcgctctcgtgaagtacctcgatggcgtcagcgaagccgat
atcgtcgagctcaatatccccaccggcatgccgctagtttatgagctcgatgacgacctc
aaacccctaaaccgctactacctcggcgacccagagaaggtgaaggccgccatggaagcc
gtcgccgcccagggcaagaagaagtag

DBGET integrated database retrieval system