KEGG   Candidatus Solibacter usitatus: Acid_4520Help
Entry
Acid_4520         CDS       T00412                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sus00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5719481..5720059
Genome map
AA seq 192 aa AA seqDB search
MKTLFFDIDSQLDFLYPAGALYVPGGERVVPAIARLNRHAAAHGIPVISTVDAHTEDDPE
FKIWPHHCVAGTTGQHKAEATLLERRVLVPNAPCELAIEGAQQVIVEKQNVDVFTAPNLT
RVIERLGAERFVVYGVVTEICVLFAARGLLKFGKPVVVVIDAVETLRAEDSAQALAEIGA
GGGTFARTADLC
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcttttcttcgatatcgattcgcaactggatttcctgtatcccgcgggtgcg
ttgtatgtgcccgggggcgaacgcgtagtgccggcgatcgcgcggctcaatcgccatgcg
gcggcccatggcatcccggtgatttccaccgtggatgcgcacaccgaggatgacccggag
ttcaagatctggccgcaccactgcgtcgcggggaccacggggcaacacaaggccgaggcg
acgctgctggaacgccgcgtcctggtgccgaatgcgccctgcgaactggcgatcgagggc
gcgcaacaggtgattgtggagaagcagaacgtcgatgtgttcaccgcgccgaatctcacg
cgcgtgatcgagcggctgggcgcggagcggttcgtggtctacggcgtagtcaccgaaatt
tgcgtcctgttcgccgcgcgcggactgctgaagttcggcaaacccgtggtggtggtcatc
gacgcggtggagacgctgcgggcggaagattcggcacaggcgctggcggagatcggcgcg
ggcggcggcaccttcgcgcgcacagcagacctttgctga

DBGET integrated database retrieval system