KEGG   Candidatus Solibacter usitatus: Acid_4607Help
Entry
Acid_4607         CDS       T00412                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Acid_4607
  Lipid metabolism
   00600 Sphingolipid metabolism
    Acid_4607
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Acid_4607
Enzymes [BR:sus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Acid_4607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5825354..5828446
Genome map
AA seq 1030 aa AA seqDB search
MVHVGTEKPHATMMAYPSAQLARTGDRAQSPWFHLLNGTWKFHGSLRPSERPVDFYRTDF
NDSAWGPMPVPASWQMHGFDVPIYTNIIYPFPQDRSKAPAPPYDFNPVGSYRRQFTVPPT
WKGRTVLLHFDGVDSAFYVWVNGHKLGYSEDSRTPAEFNLTPYLKAGSNLLAVEVYRFGD
GAYLEDQDMWRMSGIFRDVYLWSTPEQHLRDFQVNTNLDDQYRDATLAIKGTMANASEKP
AKVTITAALFDAAGAAYGKPAATTVEIGGKADAAAQIAVPAAAPRKWSAEDPYLYKLLLT
VTDASGRVLEVVPQNVGFRRVEIKGGRFLINGQAILVKGVNRHEHSEETAKYVPVESMIK
DIRLMKQFNVNAVRTSHYPNSPVWYELCDRYGIYVLDEANIECHHYGNDVRNRLTNDPEW
QTAYLDRVERMVERDKNHASVVIWSMGNESGDGPNAAAAYQWTKQRDASRPFHYEGTTSH
GGSNADINSFMYPTPERVKRAAAERPDMPLILCEYEHAMGNSSGGLKEYWDIFYSGTNAQ
GAFVWDWVDQGIRLPIPGEYKSNTSKSTFLAYGGWWEDKTGIRNDNDFNNNGLVSADRVP
HPGLYALKYVYRNLHASAVDLADGRIKIKNWFDFTNPKDLAQGTWEVKADGRTIASGKLA
PLDIEPRGEKEFTIPLPKLKPAPGVEYWLNVSFTLKQETRWAPLGHEIAWDQFALPVSLP
KAERVPSTAKLEVKDGEGEVTVSGKSFAVRFDKQAGLMTRYSYQGVTLLERGPAPDFWRA
PTNNDRGAWKSISGRPNLAKAQNIELWREAGPRWVVKNVRVEKVDDATARVMVQADLPVV
DAGYGMQYTIHGNGEIDVECRYTPGTGLAMMPRFGTELVVAPGFETFSWYGRGPKETMID
RAFERIGQYKSTVDGEWVEYMRPQENGNKVDVRWVRLTNAAGLGIEATGAAPLNVTARHY
TKTDIERAGYTFQMKRHPEVYLNLDDKQMGAGGIDSWSPNAYPMTPYRISANEEHKFSYT
LRPIAPAPKQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
gtggtccacgtcggcaccgaaaaaccgcacgccacgatgatggcgtatccctcggcccaa
ctggcgaggaccggcgatcgcgcgcagtccccgtggttccatctgctgaacggcacctgg
aagttccacggctcgctgcgccccagcgaacggccagtcgatttctatcgcaccgatttc
aacgactcggcgtggggcccgatgccggtaccggcctcctggcagatgcacggcttcgac
gttcccatatacaccaacatcatttatcctttccctcaggaccgctcgaaggcgcccgct
ccgccgtacgacttcaatcccgtgggcagttatcggcgccagttcacggttccgcccacg
tggaaaggccgcacggtcctgctgcatttcgacggtgtggactcggccttctacgtgtgg
gtgaacggccataagctgggctacagcgaggatagccggacaccggccgagttcaatctt
acgccgtatttgaaggcaggcagcaatctgctggcggtagaagtctaccgtttcggcgac
ggcgcctacctggaagaccaggacatgtggcgcatgagcggcatcttccgcgacgtgtac
ctatggagtacgccggagcagcacctgcgtgatttccaggtgaacaccaatctcgacgat
cagtaccgcgatgccacgctggcgatcaagggcacgatggccaacgcgtcggagaagccg
gcgaaggtcacgattaccgcggcgctgttcgatgccgccggcgcggcgtacggaaagccg
gccgccacgacggtggagatcggcggcaaggccgatgcggcggcgcagatcgcagttccc
gcggccgcaccgcgcaaatggtcggcggaggatccgtacctttataaactcctgctcacg
gtaacggacgcctcggggcgtgtgctcgaagtggtcccgcagaacgtgggcttccgccgc
gtggagatcaagggcgggcgtttcctgatcaacggacaggccattctggtcaagggcgtg
aaccggcacgagcacagcgaggagacggcgaagtacgtgccggtggaatccatgatcaag
gacatccggttgatgaagcagttcaacgtgaacgcggtgcggacgtcccactatcccaac
tcgccggtctggtacgaactctgcgaccgctacggcatctacgtgctggatgaagccaac
atcgaatgccaccactacggcaacgacgtccgcaaccgcctgaccaacgaccctgagtgg
cagacggcctacctggaccgcgtggagcgcatggtggagcgcgacaagaaccacgcgagc
gtggtcatctggtcgatgggcaatgagagcggcgatggccccaacgccgcggcggcttat
cagtggacgaagcagcgcgacgcttcgcggccattccactacgaaggcaccaccagccac
ggcggttccaatgccgatatcaattccttcatgtatcccacgcccgagcgcgtcaagcgc
gccgctgccgagcggcccgacatgccgctgattctctgcgagtacgagcacgcgatggga
aattcctcgggcggcctgaaggaatactgggacatcttctattcggggaccaacgcccag
ggcgcgttcgtgtgggactgggtggaccaggggatccgactgccgattcccggcgagtac
aagtccaacacgtcgaaatcgactttcctcgcgtacggcggatggtgggaagacaagacc
ggcattcgcaacgacaacgacttcaacaacaacggactggtctccgccgatcgggtgccg
catcccgggctgtacgcgttgaagtacgtgtatcgcaacctgcatgcctcggcggtggac
ctggccgatggacgcatcaaaatcaagaactggttcgacttcaccaatccaaaggacctg
gcacagggaacctgggaggtgaaggccgacggccgcacgatcgcgagcggcaagctggcg
ccgctcgatatcgagccgcgcggcgagaaggaattcacgattccgctgccgaagctgaaa
cccgcgcctggcgtggagtactggttgaacgttagcttcactttgaagcaggagacgcgc
tgggcgccgctcggacatgagatcgcgtgggaccagttcgcgctgccggtctcgctgccg
aaggcggaacgcgtccccagcactgccaaattagaggtgaaggacggggaaggcgaagtg
accgtgagcggcaagagcttcgcggtgcggttcgataagcaggccgggctgatgacgcgc
tactcctatcagggcgtgaccctgctggagcgcggtcctgcgccggacttctggcgcgcg
ccgaccaacaacgatcgcggcgcatggaagtcgattagcggccgccccaaccttgccaag
gcccagaatatcgaactctggcgcgaggccgggcctcggtgggtagtgaagaacgtgcgc
gtggagaaggtggacgacgccaccgcgcgcgtgatggtgcaggcggatctcccggtggtg
gatgccggatacggcatgcagtacacgattcacggcaatggtgagatcgacgtggagtgc
cgctatacgccggggacgggcctggcgatgatgccgcgcttcgggacggagctggtggta
gcgcccgggttcgaaacgttctcatggtacggccgcggcccgaaggagaccatgatcgac
cgcgcgttcgagcggatcggccagtacaagagcacggtagatggcgagtgggtggaatac
atgcgcccgcaggagaacggaaataaggtggacgtgcgttgggtccggctcaccaacgcc
gccggactcggcatcgaggccaccggcgccgcgccgctcaatgtgacggcgcggcactac
acgaaaaccgacatcgaacgcgcgggctacaccttccagatgaaacggcacccggaggtg
tatttgaacctcgacgataaacagatgggggcgggcggcatcgatagctggagcccgaac
gcgtacccgatgacgccttaccgcatttccgccaacgaggagcacaaattctcctatacg
ctgcggcccatcgcaccggcgcccaagcaataa

DBGET integrated database retrieval system