KEGG   Candidatus Solibacter usitatus: Acid_5070Help
Entry
Acid_5070         CDS       T00412                                 

Definition
(GenBank) signal transduction histidine kinase with CheB and CheR activity
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sus  Candidatus Solibacter usitatus
Pathway
sus02020  Two-component system
sus02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sus00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acid_5070
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Acid_5070
Enzymes [BR:sus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Acid_5070
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Acid_5070
Two-component system [BR:sus02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Acid_5070
Bacterial motility proteins [BR:sus02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Acid_5070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 PAS_4 PAS Response_reg PAS_9 PAS_8 HATPase_c CheR_N IncA HisKA HAUS-augmin3 Fez1 TPR_MLP1_2 APG6 Golgin_A5 EzrA Spc7 Exonuc_VII_L IFT57 FapA Atg14 PAS_7 DUF3584 DUF745 APG17 OKR_DC_1_N HMMR_N Not3 Herpes_UL14 Rgp1 Fusion_gly Mnd1 Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: ABJ86025
JGI: Acid5070
UniProt: Q01WE0
Position
6403090..6407529
Genome map
AA seq 1479 aa AA seqDB search
MDRHPDRESGAGASSQPTESDDHLIAVGVGASAGGLEALTDLVSHLSPHTGMAFIFVQHL
DPHHESALPELLAPRTRMPVVQVHGETRLRADHIYVIPPNNLMLVRGRKLMLEPRPAPPE
KFRPIDDLFHSLAQEFQFNAVGIVLSGTATDGTLGLKAIKAEGGITFAQNETAKFDSMPR
SAISTGVVDFVMPPAKIGEELGALARRTLNLKAAEMDPTADGSTLHRLVSLLRNQTGVDF
GQYKQATILRRLNRRMVMRRSENLDQYLVLLKQEPEEARALFADLLINVTDFFRDPDVFE
AAKRLAFPQLVRLGLGPRTIRAWIPGCSSGEEVYSIAIAMVEFLEREDLEYSVQIFGTDV
SENVIAKARAGIYDQSSLLNVSAERLRRFFVRTETGYQITRAIRDMCVFSRHNIAKDPPL
SRMNLISCRNLLIYFAPALQRRVIGTFVYALHPGGVLILGSSETLGSLAEMFSTIDEGNR
IYSRRSNLPRNAFDMYETHGEFKPRLLLPEAPQPAAAGVIGRIPREVNRIVLSRYGPCGV
VVNEALKITEYRGEVAQYLGDANAALDADLMQTVRPELRGALSVALEQARRTNVAVAAEA
LNGTDSPAVALTVVPLLLAGMAPHFLILFGERRDEVDVNGVKMAETGDNQAVSESGKVED
SAQLRQELKATREYLQSVIEELRSTNEEAQSANEELQSTNEELQTAKEELQSSNEELNTI
NAEMQSRNSDLARTNDDLINLLSSMNVPIVMTGNDLRIRRFTPMAEKVFRLIPTDIGRPI
ADLKPHINVPNLDQVLQQVIDTLQPHEQDVQDVEGRHYLMRVRPYRTFDNRIDGSVLQLL
DVSELRRNLEEIRSARDFAEAIVNTVRAPLVVLDEDLTIQDANRAFYETFAVHPSVVLKQ
PIYQAAGGRFDLPEVHKSLEAVDGRATELHDIELACRQENGETRALLLNIRRLRTPEKKH
LVLMGFEDITERKRAAEARYRRLFESARDGILLVETATGEILDVNPYTERLLGYSKRELV
GRKLWEIEPTANVPTVRALLERVRDQGALRMNDLPLLTKDGREIQTEVIANTYTEGERRA
IQFNIRDVSERKKFERELQQTQRLEGLGLLAGGIAHDFNNLLTGILGNASLAYSETAADQ
GVRMRLREIVQAAESAAFLTRQMLAYAGRGRFVIEQLDLGELVKDISALMRTSIPRTVEL
KLDLAPSLPAIDADPAQIQQVVMNLVINGAEAIGEDEIGRVTVKTSLREVTEGEVNELIF
GGQAGSYVQLEVTDTGSGMDEAVKARAFDPFFTTKFTGRGLGLAAVQGIVKGHGGNIAVY
STPGHGTTFVVLFPGSRKARKAPAAADKEVGVIPPGTVALVIDDEEAIRTLADSVLKRES
VRVMTAADGKTGVELFREHSRVISVVVLDLMMPVMGGGEALAQIKQIDPKVPVILTSGYD
ESETARRYAGLNPQGFLQKPYTAERLVEAVAAAMQQREK
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggatcggcaccctgatcgagagtccggagctggcgcttcatcgcagccaactgaaagc
gatgatcatttgatcgccgtaggagtaggtgcttccgccggaggcctggaagcgctcacg
gacctggtgtcccacctttcaccccatacgggaatggccttcatttttgtccagcatctg
gatccgcatcacgagagtgcgctgccggaactgctggctccgagaacgcggatgccggtg
gtgcaggtgcacggcgagacgcggcttcgagcggatcatatctacgtgatcccgcccaat
aacctgatgctggtgcggggtcggaagctgatgctggaacctcggccggcgccgccggag
aaattccggccgatcgacgatctttttcactcgctggcacaagaattccagttcaatgcg
gtcggcatcgtactttcgggtacagctacggatggcactctggggctaaaggcgatcaaa
gccgaaggcgggatcacattcgcgcagaacgagactgccaagttcgacagcatgccgcgc
agcgcgatttccaccggggtcgtcgatttcgtaatgccgccggccaagatcggagaggaa
ctcggcgccctggcgcggcggaccctgaatttgaaagccgcggaaatggacccaaccgcg
gacggatcgacgctgcaccgcttggtatcgctgctgcgcaaccagacaggcgttgatttt
gggcagtacaagcaggcgacgatcctgcggcgtctcaaccggcggatggtcatgcgaagg
tctgagaatctggatcagtacctggttctgctgaaacaggagccggaggaagcgagggcg
ctgttcgcagacctgctgatcaacgtcacggatttctttcgcgatccggatgtattcgag
gcggcgaagcgtcttgcattcccgcaactggtccgcctgggactgggtccgcggacaatc
cgcgcgtggataccgggatgttcgtcgggcgaggaagtatattcgatcgcgattgcgatg
gtggagtttctggaacgggaggacttggaatactcggtccagatattcggcaccgatgta
agtgagaacgtgatcgcaaaggcgcgggcgggtatctatgatcagagttcgctgttgaat
gtttccgcggagcgtctgcggcggttctttgtgcggacggaaacgggctatcagatcacg
cgcgcgattcgggatatgtgtgttttttccaggcacaatatcgccaaggacccgccgctt
tcgcggatgaacctaatcagctgccggaatctgctgatctacttcgcgcccgcgctgcag
cggcgagtgatcggcacattcgtctatgcgctgcatccgggaggggtcctgattctgggc
tcgtcagaaacgctcggctcgcttgccgagatgttttcaacgatagacgaaggtaacaga
atctacagcagaagatcgaatctgccgcgaaacgcattcgacatgtacgagacacacggg
gagttcaagccgcggcttctcttaccggaggcaccgcagcccgccgcagcgggtgtaatc
ggccgcatcccccgcgaagtcaatcgaatcgtgctctcccggtatggcccgtgcggcgtg
gtagtgaacgaagcgctaaagatcacggagtatcgcggcgaggtggcgcaatacctggga
gatgcgaacgcggcgctggatgcggatttaatgcagacggttcggcccgagctgagaggg
gcgttgagcgtggcgctggagcaggcgaggcgcacgaatgtcgcggtggcggcggaggcg
ctgaacggaaccgactcgccggcggtagcgctgacggtggtgccgttactgctggcgggg
atggcgccgcatttcctgattttgtttggggagcggcgcgacgaagtggacgtgaacgga
gtcaagatggccgagacgggcgacaaccaggcggtgagcgaatccggcaaggtggaagac
agcgctcaactccggcaggagctgaaggcgactcgggaatatctgcaatccgtaatcgaa
gagctgcgctcgaccaatgaagaggcgcaatcggcaaacgaggaacttcagagcacgaac
gaggaattacaaaccgcgaaggaagagctgcaatcctccaacgaggaactgaacaccatc
aacgcggagatgcaaagccgcaattcggacctcgcgcggaccaacgacgatttgatcaac
ctgctgagttcgatgaacgtgccgatcgtgatgaccggcaacgacctgcggatccgccgg
ttcacgccgatggcagagaaggtattccgcctgattccgaccgacattggccggccgatc
gcggatttgaaaccacacatcaacgttcccaatctggaccaggttttgcagcaggtaatc
gacacgctccagccgcatgagcaggacgtgcaggatgtggaaggacggcactacctgatg
agggtgcggccgtacaggaccttcgacaaccgtattgacggcagcgtgctgcaactgttg
gatgtgagcgaattgaggcgcaacctggaggagatccggtcggcgcgcgattttgcggaa
gcgattgtgaacacggtacgggcgccgctggtggtgctggacgaggacctgacaattcaa
gacgccaaccgggcattttacgagaccttcgcggtgcatccgagtgtggtgttgaagcag
ccgatctaccaggcggccggcgggcggttcgacttgcccgaggtgcacaagtcgctggag
gcggtggacgggcgcgcgaccgagctgcacgatatcgagctggcgtgccggcaggagaat
ggcgagacgcgagctctgctgttgaacatccggaggctgcgcacaccggagaaaaagcac
ctagttctgatgggcttcgaggacatcacggagcgcaaacgggcagccgaggcacggtac
cggcggctgtttgaatcagcgcgcgacgggatcctgctggtggagacggcgacgggtgag
attctggacgtgaatccctacacggaacgcctgctcggatattccaagcgcgaactggtg
gggcgaaagctgtgggagatcgagccgacggcgaacgtgcccacggttcgggcgctgctg
gagcgggtgcgggatcaaggcgcgctgcgaatgaatgatttgccgctgctcacgaaggat
ggccgcgaaatacagacggaggtaatcgcgaacacctacacggagggcgagcgccgcgcc
atccaatttaatatccgcgacgtcagcgagcgcaagaaattcgaacgggagttgcagcag
acgcagaggctggagggcctgggcttgctggccggaggaattgcgcacgacttcaacaac
ctgctgaccggcatcctggggaacgcgagcctggcgtattcggagacggcggcggaccag
ggagtgcggatgcggctgcgggagatcgttcaggcggcggagagcgcggcgttcctgacg
cggcagatgctcgcgtacgcgggccgggggcggttcgtgatcgagcagctggacctgggc
gagctggtgaaggacatttcggcgctgatgcgaacttcgattccgcgtacggtggaattg
aaacttgacctggcacccagtctgccggcgatcgacgcggacccggcacaaatccaacag
gtggtgatgaacctggtgatcaatggggcggaagcgattggggaagacgagatcgggcgg
gtgacggtcaagacgtcgctgcgcgaggtgaccgagggggaagtaaatgaattgatcttt
ggcgggcaggccggaagctacgtacaactggaggtgaccgacaccgggtcgggcatggat
gaggccgtgaaagcgcgggccttcgaccccttctttaccacgaaattcacggggcgcggc
ttggggctggcggcggtgcagggaatcgtgaaggggcatgggggcaacatcgcggtatac
agcactccgggtcacgggactacgttcgtggtgctgttcccggggagccgcaaagccagg
aaggcgccggccgccgccgacaaagaagttggcgtgattccgccggggaccgtcgcgttg
gtcatcgatgatgaagaggcgatccgtactctggcggacagcgtgctaaagcgtgagagc
gtgcgggtgatgaccgccgcggacgggaagaccggcgtggaactatttcgggaacactcc
cgggtgatctcggttgtggtgctggatctgatgatgccggtaatgggcgggggcgaagca
ctggcgcagattaagcagatcgatcccaaggtgccggtgattttaaccagcggctacgat
gagagcgagacggcgcgccggtatgcgggtttgaacccgcaaggttttttgcaaaaaccg
tacaccgcggagcgacttgtggaggcggtcgccgcggcgatgcagcagcgagagaagtag

DBGET integrated database retrieval system