KEGG   Candidatus Solibacter usitatus: Acid_5070Help
Entry
Acid_5070         CDS       T00412                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sus02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sus02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6403090..6407529
Genome map
AA seq 1479 aa AA seqDB search
MDRHPDRESGAGASSQPTESDDHLIAVGVGASAGGLEALTDLVSHLSPHTGMAFIFVQHL
DPHHESALPELLAPRTRMPVVQVHGETRLRADHIYVIPPNNLMLVRGRKLMLEPRPAPPE
KFRPIDDLFHSLAQEFQFNAVGIVLSGTATDGTLGLKAIKAEGGITFAQNETAKFDSMPR
SAISTGVVDFVMPPAKIGEELGALARRTLNLKAAEMDPTADGSTLHRLVSLLRNQTGVDF
GQYKQATILRRLNRRMVMRRSENLDQYLVLLKQEPEEARALFADLLINVTDFFRDPDVFE
AAKRLAFPQLVRLGLGPRTIRAWIPGCSSGEEVYSIAIAMVEFLEREDLEYSVQIFGTDV
SENVIAKARAGIYDQSSLLNVSAERLRRFFVRTETGYQITRAIRDMCVFSRHNIAKDPPL
SRMNLISCRNLLIYFAPALQRRVIGTFVYALHPGGVLILGSSETLGSLAEMFSTIDEGNR
IYSRRSNLPRNAFDMYETHGEFKPRLLLPEAPQPAAAGVIGRIPREVNRIVLSRYGPCGV
VVNEALKITEYRGEVAQYLGDANAALDADLMQTVRPELRGALSVALEQARRTNVAVAAEA
LNGTDSPAVALTVVPLLLAGMAPHFLILFGERRDEVDVNGVKMAETGDNQAVSESGKVED
SAQLRQELKATREYLQSVIEELRSTNEEAQSANEELQSTNEELQTAKEELQSSNEELNTI
NAEMQSRNSDLARTNDDLINLLSSMNVPIVMTGNDLRIRRFTPMAEKVFRLIPTDIGRPI
ADLKPHINVPNLDQVLQQVIDTLQPHEQDVQDVEGRHYLMRVRPYRTFDNRIDGSVLQLL
DVSELRRNLEEIRSARDFAEAIVNTVRAPLVVLDEDLTIQDANRAFYETFAVHPSVVLKQ
PIYQAAGGRFDLPEVHKSLEAVDGRATELHDIELACRQENGETRALLLNIRRLRTPEKKH
LVLMGFEDITERKRAAEARYRRLFESARDGILLVETATGEILDVNPYTERLLGYSKRELV
GRKLWEIEPTANVPTVRALLERVRDQGALRMNDLPLLTKDGREIQTEVIANTYTEGERRA
IQFNIRDVSERKKFERELQQTQRLEGLGLLAGGIAHDFNNLLTGILGNASLAYSETAADQ
GVRMRLREIVQAAESAAFLTRQMLAYAGRGRFVIEQLDLGELVKDISALMRTSIPRTVEL
KLDLAPSLPAIDADPAQIQQVVMNLVINGAEAIGEDEIGRVTVKTSLREVTEGEVNELIF
GGQAGSYVQLEVTDTGSGMDEAVKARAFDPFFTTKFTGRGLGLAAVQGIVKGHGGNIAVY
STPGHGTTFVVLFPGSRKARKAPAAADKEVGVIPPGTVALVIDDEEAIRTLADSVLKRES
VRVMTAADGKTGVELFREHSRVISVVVLDLMMPVMGGGEALAQIKQIDPKVPVILTSGYD
ESETARRYAGLNPQGFLQKPYTAERLVEAVAAAMQQREK
NT seq 4440 nt NT seq  +upstreamnt  +downstreamnt
atggatcggcaccctgatcgagagtccggagctggcgcttcatcgcagccaactgaaagc
gatgatcatttgatcgccgtaggagtaggtgcttccgccggaggcctggaagcgctcacg
gacctggtgtcccacctttcaccccatacgggaatggccttcatttttgtccagcatctg
gatccgcatcacgagagtgcgctgccggaactgctggctccgagaacgcggatgccggtg
gtgcaggtgcacggcgagacgcggcttcgagcggatcatatctacgtgatcccgcccaat
aacctgatgctggtgcggggtcggaagctgatgctggaacctcggccggcgccgccggag
aaattccggccgatcgacgatctttttcactcgctggcacaagaattccagttcaatgcg
gtcggcatcgtactttcgggtacagctacggatggcactctggggctaaaggcgatcaaa
gccgaaggcgggatcacattcgcgcagaacgagactgccaagttcgacagcatgccgcgc
agcgcgatttccaccggggtcgtcgatttcgtaatgccgccggccaagatcggagaggaa
ctcggcgccctggcgcggcggaccctgaatttgaaagccgcggaaatggacccaaccgcg
gacggatcgacgctgcaccgcttggtatcgctgctgcgcaaccagacaggcgttgatttt
gggcagtacaagcaggcgacgatcctgcggcgtctcaaccggcggatggtcatgcgaagg
tctgagaatctggatcagtacctggttctgctgaaacaggagccggaggaagcgagggcg
ctgttcgcagacctgctgatcaacgtcacggatttctttcgcgatccggatgtattcgag
gcggcgaagcgtcttgcattcccgcaactggtccgcctgggactgggtccgcggacaatc
cgcgcgtggataccgggatgttcgtcgggcgaggaagtatattcgatcgcgattgcgatg
gtggagtttctggaacgggaggacttggaatactcggtccagatattcggcaccgatgta
agtgagaacgtgatcgcaaaggcgcgggcgggtatctatgatcagagttcgctgttgaat
gtttccgcggagcgtctgcggcggttctttgtgcggacggaaacgggctatcagatcacg
cgcgcgattcgggatatgtgtgttttttccaggcacaatatcgccaaggacccgccgctt
tcgcggatgaacctaatcagctgccggaatctgctgatctacttcgcgcccgcgctgcag
cggcgagtgatcggcacattcgtctatgcgctgcatccgggaggggtcctgattctgggc
tcgtcagaaacgctcggctcgcttgccgagatgttttcaacgatagacgaaggtaacaga
atctacagcagaagatcgaatctgccgcgaaacgcattcgacatgtacgagacacacggg
gagttcaagccgcggcttctcttaccggaggcaccgcagcccgccgcagcgggtgtaatc
ggccgcatcccccgcgaagtcaatcgaatcgtgctctcccggtatggcccgtgcggcgtg
gtagtgaacgaagcgctaaagatcacggagtatcgcggcgaggtggcgcaatacctggga
gatgcgaacgcggcgctggatgcggatttaatgcagacggttcggcccgagctgagaggg
gcgttgagcgtggcgctggagcaggcgaggcgcacgaatgtcgcggtggcggcggaggcg
ctgaacggaaccgactcgccggcggtagcgctgacggtggtgccgttactgctggcgggg
atggcgccgcatttcctgattttgtttggggagcggcgcgacgaagtggacgtgaacgga
gtcaagatggccgagacgggcgacaaccaggcggtgagcgaatccggcaaggtggaagac
agcgctcaactccggcaggagctgaaggcgactcgggaatatctgcaatccgtaatcgaa
gagctgcgctcgaccaatgaagaggcgcaatcggcaaacgaggaacttcagagcacgaac
gaggaattacaaaccgcgaaggaagagctgcaatcctccaacgaggaactgaacaccatc
aacgcggagatgcaaagccgcaattcggacctcgcgcggaccaacgacgatttgatcaac
ctgctgagttcgatgaacgtgccgatcgtgatgaccggcaacgacctgcggatccgccgg
ttcacgccgatggcagagaaggtattccgcctgattccgaccgacattggccggccgatc
gcggatttgaaaccacacatcaacgttcccaatctggaccaggttttgcagcaggtaatc
gacacgctccagccgcatgagcaggacgtgcaggatgtggaaggacggcactacctgatg
agggtgcggccgtacaggaccttcgacaaccgtattgacggcagcgtgctgcaactgttg
gatgtgagcgaattgaggcgcaacctggaggagatccggtcggcgcgcgattttgcggaa
gcgattgtgaacacggtacgggcgccgctggtggtgctggacgaggacctgacaattcaa
gacgccaaccgggcattttacgagaccttcgcggtgcatccgagtgtggtgttgaagcag
ccgatctaccaggcggccggcgggcggttcgacttgcccgaggtgcacaagtcgctggag
gcggtggacgggcgcgcgaccgagctgcacgatatcgagctggcgtgccggcaggagaat
ggcgagacgcgagctctgctgttgaacatccggaggctgcgcacaccggagaaaaagcac
ctagttctgatgggcttcgaggacatcacggagcgcaaacgggcagccgaggcacggtac
cggcggctgtttgaatcagcgcgcgacgggatcctgctggtggagacggcgacgggtgag
attctggacgtgaatccctacacggaacgcctgctcggatattccaagcgcgaactggtg
gggcgaaagctgtgggagatcgagccgacggcgaacgtgcccacggttcgggcgctgctg
gagcgggtgcgggatcaaggcgcgctgcgaatgaatgatttgccgctgctcacgaaggat
ggccgcgaaatacagacggaggtaatcgcgaacacctacacggagggcgagcgccgcgcc
atccaatttaatatccgcgacgtcagcgagcgcaagaaattcgaacgggagttgcagcag
acgcagaggctggagggcctgggcttgctggccggaggaattgcgcacgacttcaacaac
ctgctgaccggcatcctggggaacgcgagcctggcgtattcggagacggcggcggaccag
ggagtgcggatgcggctgcgggagatcgttcaggcggcggagagcgcggcgttcctgacg
cggcagatgctcgcgtacgcgggccgggggcggttcgtgatcgagcagctggacctgggc
gagctggtgaaggacatttcggcgctgatgcgaacttcgattccgcgtacggtggaattg
aaacttgacctggcacccagtctgccggcgatcgacgcggacccggcacaaatccaacag
gtggtgatgaacctggtgatcaatggggcggaagcgattggggaagacgagatcgggcgg
gtgacggtcaagacgtcgctgcgcgaggtgaccgagggggaagtaaatgaattgatcttt
ggcgggcaggccggaagctacgtacaactggaggtgaccgacaccgggtcgggcatggat
gaggccgtgaaagcgcgggccttcgaccccttctttaccacgaaattcacggggcgcggc
ttggggctggcggcggtgcagggaatcgtgaaggggcatgggggcaacatcgcggtatac
agcactccgggtcacgggactacgttcgtggtgctgttcccggggagccgcaaagccagg
aaggcgccggccgccgccgacaaagaagttggcgtgattccgccggggaccgtcgcgttg
gtcatcgatgatgaagaggcgatccgtactctggcggacagcgtgctaaagcgtgagagc
gtgcgggtgatgaccgccgcggacgggaagaccggcgtggaactatttcgggaacactcc
cgggtgatctcggttgtggtgctggatctgatgatgccggtaatgggcgggggcgaagca
ctggcgcagattaagcagatcgatcccaaggtgccggtgattttaaccagcggctacgat
gagagcgagacggcgcgccggtatgcgggtttgaacccgcaaggttttttgcaaaaaccg
tacaccgcggagcgacttgtggaggcggtcgccgcggcgatgcagcagcgagagaagtag

DBGET integrated database retrieval system