KEGG   Candidatus Solibacter usitatus: Acid_5081Help
Entry
Acid_5081         CDS       T00412                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sus00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acid_5081
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Acid_5081
Enzymes [BR:sus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Acid_5081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6417121..6418143)
Genome map
AA seq 340 aa AA seqDB search
MPALPLRRNAHNHDPVPAKRWNAMFANSGARNLAGQMALHAEMCNEGLDCLTGGQIGNVH
YSPDFVLWHRAFLYYHEQILGVLGDGTPVGLSYWEWSGDRLCPPAYEAAQFDFRKHLMHS
KQELTDENFAPEQILAVVAALRSMPPENAAVEMFDEPIHAIPHNRFGWDRRSDLMTAAGD
PLFYGHHGNLDRLATHIFEKGWPKPTGISYHFVGPDGKQVCTKLDRFAAMASPYEGDQPI
DTSGYQVTKFEGSAPVRSGSYSRVRMKLRFGGPVPNGLHQVISGKGRRVGEIASNHHGTT
NFIVWVSPEEHNEGRSVGLLLADTHVRADIGPSILVTSRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactgcccttgcgccgcaatgcgcataaccacgacccggtaccggcgaagcgg
tggaacgcgatgttcgccaatagcggcgcgcgaaatctcgcgggacagatggctctgcac
gccgagatgtgcaatgagggcctcgactgtcttacaggaggccaaatcggcaacgttcac
tattctcccgatttcgttttatggcaccgcgcgttcctctattaccacgagcagattctg
ggcgtattgggtgatgggacccccgtgggtctttcctactgggagtggtccggggaccgg
ctatgtccgcccgcctatgaggcggcgcagttcgatttccgcaagcacctgatgcacagc
aagcaggagttgaccgacgagaatttcgcgccggagcagatcctggccgtggtcgccgcg
ctgcgcagcatgccgccggagaacgccgcggtcgagatgttcgacgagccgatccacgcc
atcccgcacaatcgcttcggatgggatcgccggtccgacttaatgaccgccgccggcgat
ccgctcttctatgggcatcacggtaacctggatcgcctggctactcatatcttcgagaag
ggatggcctaagccaaccgggatcagctatcactttgtgggccccgacggcaagcaggtc
tgcacgaaactggaccggttcgccgccatggcgagcccgtacgagggcgatcagccgatc
gatacctccggttaccaggttacgaagttcgaaggcagcgccccagtccggagtggcagt
tatagccgcgtcaggatgaaactacggtttggaggcccggtgccgaacgggctccaccag
gtgatttcggggaagggaaggcgcgtgggtgagatcgccagtaaccatcacggcaccact
aacttcatcgtgtgggtgagccccgaggaacataacgaggggagatccgtgggtcttctc
ctcgccgacactcacgtaagggcggacatcgggccgtcgatcctggtaacgagccgcagg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system