KEGG   Candidatus Solibacter usitatus: Acid_5220Help
Entry
Acid_5220         CDS       T00412                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sus  Candidatus Solibacter usitatus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sus00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sus00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sus02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6551945..6553600
Genome map
AA seq 551 aa AA seqDB search
MTLNRREFVQLAAAMGASLAWGGSARASTTGWHERRDLYPEGVASGDPDPSSVILWTRRP
FESGGRRVLTVEVAEDDAFRRVVAKASAPVSAESDWTTRVLVGHLKPARVYWYRFIDGEA
NGSRVGRTITAPPANDPRPVNFAFVSCQSVNEGKLNGYRRMIFEDERAAPADQLGFVLHL
GDFIYEVVEYPDELPTRYDRTIYEVCRIPDGGQTGKFHYPLTVEGYRAVYKGYLADPDLQ
DARARWPFVAIWDNHEFSWQGRQSIVQAGGAPQPGQTVKVAANQAWFEYIPARVNAPSGS
LDTFGAVAVKNVPIETWDDSGLGIEPNNLKAINSLIAYRSLRYGRHLDLILTDQHSFCGD
DPTDAEGVGKIYDPAFNGMFSEPAMIALDAGRTFNGGKPPAELSFGDVSIPNPRKDSPPR
TLLGTRQKNWFMDQLRRSAATWKIWGNSLGALDLRADPQNLPDGLTKQKWPADTFAQIGS
GDYGSAYHERGEIYDLVRDSKITGFAIVSGDRHSFWAGYAASRLPPAKFEPVGISFVGAS
LASPGAMEGGL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcaatcgacgcgagttcgttcaattggcggcggcgatgggagcgtcgctggcg
tggggcggatcggctcgagcgtcaaccaccggttggcatgagcggcgcgacctttatccg
gagggcgtcgcgtccggcgatcccgatccgagctctgttatcctttggacccggaggccg
ttcgagtcgggcggccggcgtgtgcttacggtggaggttgcggaggatgatgcgttccgg
cgggtcgtcgcaaaggcgtccgcgccggtctcagcggaatcggattggacgacgcgcgtg
ctggtcggtcatctcaagcctgcgcgcgtctactggtaccgcttcatcgatggagaggcc
aacggcagccgcgtaggccggacgatcaccgcaccgccggcgaacgatccacggccggtc
aatttcgcctttgtcagctgccagagcgttaatgaaggcaagctcaacggctatcgccgg
atgatctttgaggatgagcgcgcggctcccgccgatcaactcggtttcgttctccacctc
ggtgatttcatttacgaggtcgtcgaatatcccgacgagctgccgacgcggtacgaccgc
acgatctacgaagtctgccggattcccgatggcggccaaaccggcaaattccattacccg
ctaacggtcgagggctaccgcgccgtctacaagggctaccttgccgatcccgacctgcaa
gacgcgcgggcacgttggccgttcgtcgcgatctgggacaatcacgaattctcctggcag
ggccggcagagcatcgtccaggcagggggcgctccgcaaccgggccagactgtgaaggtc
gccgccaaccaggcgtggttcgaatatattcccgcacgcgtgaatgcgccgagcggatcg
ctcgacacgttcggcgcggtggcggtgaaaaatgtgccgatagaaacgtgggacgacagc
ggcctcgggatcgaacccaacaacctgaaggccatcaacagcctgatcgcctaccggtct
ttgcgctacggccggcacctcgatctcattctcaccgaccagcacagcttctgcggcgac
gacccgaccgatgcggagggcgtcggcaagatttacgatccggcttttaacgggatgttc
tcggaaccggcgatgatcgcgctcgatgccggccgcaccttcaacgggggcaaaccgccc
gccgaactcagctttggcgacgtaagcatccctaatcctcgaaaggattcaccgccgcgc
acgttgctcgggacccgtcagaagaattggttcatggaccagctccgccggtccgcggca
acctggaagatctggggcaattcgctcggtgccctcgatttgcgggccgacccgcagaac
cttcccgatgggctgaccaagcagaagtggccggccgacaccttcgcgcagatcggcagc
ggcgattatggcagcgcctaccacgagcgcggcgaaatctatgacctcgtccgtgattcg
aagatcaccggattcgcgatcgtgtcgggcgaccgtcacagcttttgggccggctatgcc
gcctcccgattgccacccgccaaattcgagccggtcgggatcagtttcgttggcgcctcg
ctggccagccctggggcgatggagggaggcttatga

DBGET integrated database retrieval system